PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00001689.1.g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 292aa    MW: 33285.1 Da    PI: 6.9545
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00001689.1.g00002.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM95.77e-3057754128
                             NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +   ++ g+kk Lvfy g+apkg+kt+W+mheyrl
  FANhyb_rscf00001689.1.g00002.1   5 GEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKHIGK--PKALGIKKALVFYAGKAPKGVKTNWIMHEYRL 77 
                                     579************************************98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100540.6081104IPR003441NAC domain
SuperFamilySSF1019417.85E-363104IPR003441NAC domain
PfamPF023651.4E-14977IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MALYGEKEWY FFSPRDRKYP NGSRPNRAAG TGYWKATGAD KHIGKPKALG IKKALVFYAG  60
KAPKGVKTNW IMHEYRLANV DRSASKKNHN LRLDDWVLCR IYNKKGSIEK YNTATVERNR  120
FPTYSEIMDH EEKPELKNIQ FNVAPSQVQQ MPSAVAPVTQ HTDVLSGDYS APRLQHTQHT  180
TDYSSCSDHV FSPEVQSEFQ WSSSPEFSEL DNSMNMNFLE SNDQFNYMDG FSLADIDDPF  240
GNQAQAQAQT QYQMDQQDLF ILCEYAMSPI SGYQGPGSLS SKLNENEKLR KA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-49211066171NO APICAL MERISTEM PROTEIN
1ut4_B2e-49211066171NO APICAL MERISTEM PROTEIN
1ut7_A2e-49211066171NO APICAL MERISTEM PROTEIN
1ut7_B2e-49211066171NO APICAL MERISTEM PROTEIN
3swm_A2e-49211069174NAC domain-containing protein 19
3swm_B2e-49211069174NAC domain-containing protein 19
3swm_C2e-49211069174NAC domain-containing protein 19
3swm_D2e-49211069174NAC domain-containing protein 19
3swp_A2e-49211069174NAC domain-containing protein 19
3swp_B2e-49211069174NAC domain-containing protein 19
3swp_C2e-49211069174NAC domain-containing protein 19
3swp_D2e-49211069174NAC domain-containing protein 19
4dul_A2e-49211066171NAC domain-containing protein 19
4dul_B2e-49211066171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004288488.10.0PREDICTED: NAC domain-containing protein 2-like
SwissprotQ390132e-74NAC2_ARATH; NAC domain-containing protein 2
TrEMBLA0A0E3UPZ11e-168A0A0E3UPZ1_ROSCH; Putative NAC-4 protein
STRINGXP_004288488.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.13e-76NAC family protein
Publications ? help Back to Top
  1. Florentin A,Damri M,Grafi G
    Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization.
    Dev. Dyn., 2013. 242(10): p. 1121-33
    [PMID:23798027]
  2. Jensen MK, et al.
    ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana.
    FEBS Open Bio, 2013. 3: p. 321-7
    [PMID:23951554]
  3. Wang YX
    Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
    Mol. Biol. Rep., 2013. 40(11): p. 6451-8
    [PMID:24057250]
  4. Yang X, et al.
    Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis.
    Plant Cell Rep., 2015. 34(6): p. 943-58
    [PMID:25666276]
  5. Du Q,Wang H
    The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
    Plant Signal Behav, 2015. 10(10): p. e1078955
    [PMID:26340415]
  6. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  7. Liu Y,Sun J,Wu Y
    Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice.
    J. Plant Res., 2016. 129(5): p. 955-962
    [PMID:27216423]
  8. Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR
    Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining.
    PLoS ONE, 2016. 11(9): p. e0162327
    [PMID:27618630]
  9. Zhao J,Missihoun TD,Bartels D
    The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana.
    Planta, 2018. 248(4): p. 1017-1027
    [PMID:30027414]