PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00001352.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 245aa    MW: 28037.9 Da    PI: 9.3004
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00001352.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.21.4e-52151421128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     + pGfrFhPtdeelv +yLk+k++++ l++ e ik+vdiyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t 
  FANhyb_rscf00001352.1.g00001.1  15 MLPGFRFHPTDEELVGFYLKRKIQQRLLPI-ELIKQVDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSARPNRVTG 92 
                                     579***************************.89***************9888999************************ PP

                             NAM  80 sgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     +g+Wkatg+d++++s+ +++ +glkk+Lvfy+gra kg ktdW+mhe+rl
  FANhyb_rscf00001352.1.g00001.1  93 AGFWKATGTDRPIYSSeGSKCIGLKKSLVFYRGRAAKGIKTDWMMHEFRL 142
                                     ***************956677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-5714173IPR003441NAC domain
PROSITE profilePS5100556.70415173IPR003441NAC domain
PfamPF023655.5E-2617142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGEKNDQMDK VDDVMLPGFR FHPTDEELVG FYLKRKIQQR LLPIELIKQV DIYKYDPWDL  60
PKLASTGEKE WYFYCPRDRK YRNSARPNRV TGAGFWKATG TDRPIYSSEG SKCIGLKKSL  120
VFYRGRAAKG IKTDWMMHEF RLPSIADSSP PKKLLDKSLP PNDAWAICRI FKKTNSMAQR  180
ALSQSWLSPL PEPTSSGFLT QCPQFSSENN ISCTTDLGSA IQFWSNNNDL QHQQASTYSA  240
FDALS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-5511761171Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024184957.11e-179putative NAC domain-containing protein 94
SwissprotQ9ZVH01e-105FEZ_ARATH; Protein FEZ
TrEMBLA0A2P6S4M61e-177A0A2P6S4M6_ROSCH; Putative transcription factor NAM family
STRINGXP_004306150.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-101NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]