PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00001223.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Trihelix
Protein Properties Length: 316aa    MW: 36914.4 Da    PI: 6.7491
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00001223.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix81.11.5e-2564145185
                        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstc 79 
                                     +W+ qe+++Li++r e+++++ ++k++k+lWe ++ +m+++g +rs++qCk+kw+nl +ryk +++ e +     ++++
  FANhyb_rscf00001223.1.g00001.1  64 QWSLQETKELITIRAELDQTFMETKRNKQLWEVIATQMKDKGHNRSAEQCKCKWKNLVTRYKGCETAEAET---MRQQF 139
                                     7********************************************************************84...55679 PP

                        trihelix  80 pyfdql 85 
                                     p+f++l
  FANhyb_rscf00001223.1.g00001.1 140 PFFNDL 145
                                     ****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.5E-461123IPR001005SANT/Myb domain
CDDcd122032.13E-2463128No hitNo description
SuperFamilySSF466894.89E-563127IPR009057Homeodomain-like
PfamPF138375.3E-2064146No hitNo description
Gene3DG3DSA:1.10.10.601.3E-464120IPR009057Homeodomain-like
PROSITE profilePS500908.0665121IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MDGHYPHRLH QQQQQELHQF QLQHQFQVVQ QPQQLLPPPP PHQHQHLSPP PITVHVDASD  60
RFPQWSLQET KELITIRAEL DQTFMETKRN KQLWEVIATQ MKDKGHNRSA EQCKCKWKNL  120
VTRYKGCETA EAETMRQQFP FFNDLATIMV AREQRLPGTE ADGNGGASGS KKKAAAVAVS  180
SDEDDEDHED SEEAGEKGIT SARKKKKVMK TGNIGSSSTG MGLGGNNVKE ILEDFMRQQL  240
QLDMQWRDEF QARENERRMR EYEWRQTMEA IENERLMAER EWREREERRR MREEARAEKR  300
DAILTALLDR LNRGGM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004302587.11e-168PREDICTED: trihelix transcription factor GT-3b
RefseqXP_011466470.11e-168PREDICTED: trihelix transcription factor GT-3b
SwissprotO804503e-64TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLB9HCX76e-96B9HCX7_POPTR; Uncharacterized protein
STRINGPOPTR_0006s10240.12e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.11e-56Trihelix family protein