PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00001144.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GRAS
Protein Properties Length: 463aa    MW: 51775.2 Da    PI: 5.5923
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00001144.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS310.34.4e-95584602373
                            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvs.elykalppsetseknsseela 79 
                                     ++lL++cA+a++++d++laq++L+ l+++a pdgd++qRl+  f++AL ar ars+s +l +a+++ +++   ++++++
  FANhyb_rscf00001144.1.g00001.1  58 EQLLVHCANAIETNDATLAQQILWVLNNIAPPDGDSNQRLTCAFLRALIARAARSGSlKLLAAMNAAQANLAIHTHKFS 136
                                     79****************************************************5442677777888877666888888 PP

                            GRAS  80 alkl..fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesg 153
                                     + +l  f +++P+++f++ +aN aIleaveg + +Hi+D+++++++Q p+L +a+asR+     pp l++T+ g  e +
  FANhyb_rscf00001144.1.g00001.1 137 VIELagFIDLTPWHRFGFTAANAAILEAVEGFSVIHIVDLSLTHCMQIPTLVDAIASRQdglTTPPLLKLTVAGTTEDV 215
                                     888899*****************************************************65556***********8877 PP

                            GRAS 154 ...skeeleetgerLakfAeelgvpfefnvl.......vakrledleleeLrvkp.......gEalaVnlvlqlhrll. 214
                                           ++ee+g++L +fA++ ++ +ef+v+        a+      +e+Lrv++       +Eal++n++++lh+++ 
  FANhyb_rscf00001144.1.g00001.1 216 ppmLDLSYEELGSKLVNFARSRNIILEFRVIpssytdgFANL-----IEQLRVQNlvypesgHEALVINCHMMLHYIPe 289
                                     98888999***********************88844444444.....555555555555699***************** PP

                            GRAS 215 ..............desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                                                   + ++s++s r+ +Lk+v++l P+vvv+v+++ad++s++++ r+ +a++y +  +d++++ lpr s
  FANhyb_rscf00001144.1.g00001.1 290 etfqnfepcsssstSITTSSTSLRSMFLKAVRGLDPTVVVLVDEDADLTSNDLVGRLRSAFNYLWIPYDTVDTFLPRGS 368
                                     **********998755555555788****************************************************** PP

                            GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                                     ++r+++E+  + ++i+nv+a eg++r+er e + +W +r+++aGF++vp++e+a++++k++l +++  g+ ++ e++ l
  FANhyb_rscf00001144.1.g00001.1 369 KQRQWYEAD-VCWKIENVIAYEGFQRVERLEPKCRWVQRMRSAGFRSVPFGEEAVNEVKAMLDEHA-AGWGLKREEEDL 445
                                     *********.99******************************************************.8999******** PP

                            GRAS 359 vlgWkdrpLvsvSaW 373
                                     vl+Wk++++v+++aW
  FANhyb_rscf00001144.1.g00001.1 446 VLTWKGHNVVFATAW 460
                                     *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.32531442IPR005202Transcription factor GRAS
PfamPF035141.5E-9258460IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MMQFTETPPQ PLHQIVTTPP FSPNLPIMNK NQTNRTRPWP GFPTSSKLTN FGDANCMEQL  60
LVHCANAIET NDATLAQQIL WVLNNIAPPD GDSNQRLTCA FLRALIARAA RSGSLKLLAA  120
MNAAQANLAI HTHKFSVIEL AGFIDLTPWH RFGFTAANAA ILEAVEGFSV IHIVDLSLTH  180
CMQIPTLVDA IASRQDGLTT PPLLKLTVAG TTEDVPPMLD LSYEELGSKL VNFARSRNII  240
LEFRVIPSSY TDGFANLIEQ LRVQNLVYPE SGHEALVINC HMMLHYIPEE TFQNFEPCSS  300
SSTSITTSST SLRSMFLKAV RGLDPTVVVL VDEDADLTSN DLVGRLRSAF NYLWIPYDTV  360
DTFLPRGSKQ RQWYEADVCW KIENVIAYEG FQRVERLEPK CRWVQRMRSA GFRSVPFGEE  420
AVNEVKAMLD EHAAGWGLKR EEEDLVLTWK GHNVVFATAW MPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B6e-485246282474Protein SHORT-ROOT
5b3h_B2e-485246228420Protein SHORT-ROOT
5b3h_E2e-485246228420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004303852.20.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN220.0SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A2P6RNY80.0A0A2P6RNY8_ROSCH; Putative transcription factor GRAS family
STRINGXP_004303852.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-175GRAS family protein