PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00001065.1.g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 176aa    MW: 19522.2 Da    PI: 7.1476
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00001065.1.g00008.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.99.8e-4561051100
                          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgv 79 
                                     +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg 
  FANhyb_rscf00001065.1.g00008.1   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPLHQRGDAVSSLVYEANARVRDPVYGCVGA 84 
                                     7****************************************************************************** PP

                          DUF260  80 ilklqqqleqlkaelallkee 100
                                     i+ lq+q+++l+ +la++++e
  FANhyb_rscf00001065.1.g00008.1  85 ISFLQNQVSNLQMQLAVAQAE 105
                                     ****************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7765106IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-436103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MGGTSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK VFGASNVSKM LQELPLHQRG  60
DAVSSLVYEA NARVRDPVYG CVGAISFLQN QVSNLQMQLA VAQAEILCIQ MQQEPVAATL  120
PASQMLDHHQ YQDHDQKSLL LSNTHDFSNI PQYLSSFGSS SSNVIQDPLK RESLWT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004296053.11e-127PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW34e-80LBD12_ARATH; LOB domain-containing protein 12
TrEMBLM5W0D74e-98M5W0D7_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s28840.11e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-81LBD family protein