PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00001064.1.g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 146aa    MW: 17104.4 Da    PI: 7.9262
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00001064.1.g00002.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.91.1e-1366124563
                                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                     +r +r+++NRe+ArrsR RKk++i+eL+ +v++L   N +L ++l +l +  ++  +e+
  FANhyb_rscf00001064.1.g00002.1  66 RRLKRLISNRESARRSRMRKKKQIQELKHEVDQLYVANNQLYEKLIRLLEVNQRILQEN 124
                                     689********************************************999998888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.8E-962126IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.47364127IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.68E-1166115No hitNo description
Gene3DG3DSA:1.20.5.1709.4E-1166134No hitNo description
PfamPF001706.0E-1266124IPR004827Basic-leucine zipper domain
CDDcd147028.90E-1467115No hitNo description
PROSITE patternPS0003606984IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MDPNESKTHY HLANQTIPSQ LLPTIPHTQI FPMSHFNDIS PYTYTVSTNT VFDETAAAEQ  60
SLNHERRLKR LISNRESARR SRMRKKKQIQ ELKHEVDQLY VANNQLYEKL IRLLEVNQRI  120
LQENAELKET VSSLQVTFTD LIDVTL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301090.14e-76PREDICTED: basic leucine zipper 43
TrEMBLM5WVR41e-51M5WVR4_PRUPE; Uncharacterized protein
STRINGXP_004301090.12e-75(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.11e-26basic leucine-zipper 70