PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000957.1.g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GATA
Protein Properties Length: 406aa    MW: 45040.5 Da    PI: 4.7809
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000957.1.g00002.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.11.2e-18325358134
                            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                                     Cs+C++ kTp+WR gp g+ktLCnaCG++y++ +
  FANhyb_rscf00000957.1.g00002.1 325 CSHCQVQKTPQWRTGPLGPKTLCNACGVRYKSGR 358
                                     *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.8E-15319373IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.47E-14322382No hitNo description
PROSITE profilePS5011411.332323355IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.0E-14323356IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.17E-14324373No hitNo description
PfamPF003202.1E-16325358IPR000679Zinc finger, GATA-type
PROSITE patternPS003440325350IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MELCMEARAL KSSLRRELAM KSTQHALMEE LWCATAISGV PSEDFSVDDL LDFSNSQFEN  60
GSVEEEIYEF SVCVMLVLMV EVLAMKSTQH GLMEELWCAT AISGVPSEDF SVDDLLDFSN  120
GQFEDGSVEE EQELEEHEEE EEDKDSVSVD SVENSNSSYF TTESTLASQL AVPSLNGFLT  180
LWTTLLQSFS LLHPVSKLKP EALTLNRSEP EARRLALAHD QSTLSWLPSQ VPVKARSKRF  240
RPASRLRSSV WNPLGDSPSL TSSLPSPSST SSCSSGMSLS TPSLVLTNPV HKVGVFWGES  300
AAKKQKRKPA VQTGDEVVVG IQRRCSHCQV QKTPQWRTGP LGPKTLCNAC GVRYKSGRLF  360
PEYRPACSPT FSGDVHSNSH RKVLEMRRRK DTGEPEPDEQ NDSREL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004290341.11e-175PREDICTED: GATA transcription factor 5-like
TrEMBLD9ZIZ03e-98D9ZIZ0_MALDO; GATA domain class transcription factor
STRINGPOPTR_0004s16860.11e-66(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.25e-39GATA transcription factor 5