PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000800.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family TCP
Protein Properties Length: 103aa    MW: 10699.9 Da    PI: 7.4205
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000800.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP62.31.8e-192190473
                             TCP  4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73
                                    +k ++s  h k +g    +Rl+ +c ar+ +L+deLGfd +++t+eWLl++ +p+i ++tg + ss +  
  FANhyb_rscf00000800.1.g00001.1 21 GKASTSVGHGKDEGGECGIRLPKKCVARLVQLTDELGFDNNGQTVEWLLNKVEPSIVAATGRGVSSINTP 90
                                    688899999999999999********************************************44444222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136911.9572579IPR017887Transcription factor TCP subgroup
PfamPF036341.5E-143990IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MGTVPNFSTK ASSSSNQLFH GKASTSVGHG KDEGGECGIR LPKKCVARLV QLTDELGFDN  60
NGQTVEWLLN KVEPSIVAAT GRGVSSINTP STQAPAPSTQ ATE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011459879.14e-68PREDICTED: transcription factor TCP9-like
TrEMBLA0A2P5YC808e-16A0A2P5YC80_GOSBA; Uncharacterized protein
STRINGXP_002529440.11e-15(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3423522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.12e-17TCP family protein