PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000642.1.g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 361aa    MW: 39901.3 Da    PI: 7.208
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000642.1.g00006.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.92e-53151421128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+e+d+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++
  FANhyb_rscf00000642.1.g00006.1  15 LPPGFRFHPTDEELVVHYLKKKAASVPLPV-TIIAEIDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGARPNRAAT 92 
                                     79****************************.89***************8888999************************ PP

                             NAM  80 sgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     sgyWkatg+dk++l++ ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  FANhyb_rscf00000642.1.g00006.1  93 SGYWKATGTDKPILTSnGSQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 142
                                     *************99867888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.55E-659177IPR003441NAC domain
PROSITE profilePS5100562.24915177IPR003441NAC domain
PfamPF023656.7E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MESTDSSSGS GHPQLPPGFR FHPTDEELVV HYLKKKAASV PLPVTIIAEI DLYKFDPWEL  60
PSKATFGEQE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPILTSNG SQKVGVKKAL  120
VFYGGKPPKG IKTNWIMHEY RLINDDNSSA ALKPPDPTNK KASLRLDDWV LCRIYKKNNA  180
QRPMMECDHH LHKEEDSTTN SMEGIFVQSM TKPSPQKAAT NYTALLENDE EDNFFDGILS  240
SEGVQNSSHS NLSHQFMSSS KSDVVVMPVN NNNSKRQLPS PFWNEEGGSS SMGTNNSSSS  300
KRFHTDLNGG GGSGGGVDES NASFVSMLNQ NAAFHHNSLL GSLGDGVLRP QFHLPSMNWN  360
S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-761518017168NO APICAL MERISTEM PROTEIN
1ut4_B1e-761518017168NO APICAL MERISTEM PROTEIN
1ut7_A1e-761518017168NO APICAL MERISTEM PROTEIN
1ut7_B1e-761518017168NO APICAL MERISTEM PROTEIN
3swm_A1e-761518020171NAC domain-containing protein 19
3swm_B1e-761518020171NAC domain-containing protein 19
3swm_C1e-761518020171NAC domain-containing protein 19
3swm_D1e-761518020171NAC domain-containing protein 19
3swp_A1e-761518020171NAC domain-containing protein 19
3swp_B1e-761518020171NAC domain-containing protein 19
3swp_C1e-761518020171NAC domain-containing protein 19
3swp_D1e-761518020171NAC domain-containing protein 19
4dul_A1e-761518017168NAC domain-containing protein 19
4dul_B1e-761518017168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293567.10.0PREDICTED: NAC transcription factor 25
SwissprotQ8GY421e-118NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A286LLT30.0A0A286LLT3_ROSCH; NAC family protein
STRINGXP_004293567.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-120NAC domain containing protein 25