PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000534.1.g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 177aa    MW: 20026.7 Da    PI: 10.2875
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000534.1.g00007.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM104.61.3e-32158854128
                             NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     ++ ew+fF++rd+ky++g+r+nratk+gyWkatgkd++v++ +++++g +ktLvfy+grap g +tdW+mheyrl
  FANhyb_rscf00000534.1.g00007.1  15 RDMEWFFFCPRDRKYPNGSRTNRATKAGYWKATGKDRKVVC-QSSVTGYRKTLVFYRGRAPLGDRTDWIMHEYRL 88 
                                     578**************************************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100537.0431111IPR003441NAC domain
SuperFamilySSF1019412.22E-3713111IPR003441NAC domain
PfamPF023651.4E-161888IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MFVLSIAEKS FLPRRDMEWF FFCPRDRKYP NGSRTNRATK AGYWKATGKD RKVVCQSSVT  60
GYRKTLVFYR GRAPLGDRTD WIMHEYRLND DFAQGSPGHK GVFALCRVVK KNEHTQKAND  120
CSAEPKAKTV GSTSSNGDLT STINSNETLS ISAGMSSQVN YMQYLKHGMD KLQFSGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-311611770171NO APICAL MERISTEM PROTEIN
1ut4_B6e-311611770171NO APICAL MERISTEM PROTEIN
1ut7_A6e-311611770171NO APICAL MERISTEM PROTEIN
1ut7_B6e-311611770171NO APICAL MERISTEM PROTEIN
3swm_A6e-311611773174NAC domain-containing protein 19
3swm_B6e-311611773174NAC domain-containing protein 19
3swm_C6e-311611773174NAC domain-containing protein 19
3swm_D6e-311611773174NAC domain-containing protein 19
3swp_A6e-311611773174NAC domain-containing protein 19
3swp_B6e-311611773174NAC domain-containing protein 19
3swp_C6e-311611773174NAC domain-containing protein 19
3swp_D6e-311611773174NAC domain-containing protein 19
4dul_A6e-311611770171NAC domain-containing protein 19
4dul_B6e-311611770171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269|PubMed:21911380, ECO:0000269|PubMed:25182467, ECO:0000269|PubMed:27986917}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding in the flowering stem. {ECO:0000269|PubMed:21911380}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300256.11e-112PREDICTED: protein ATAF2-like
RefseqXP_011465166.11e-112PREDICTED: protein ATAF2-like
SwissprotO496972e-57NAC71_ARATH; NAC domain-containing protein 71
TrEMBLA0A2P6P9V91e-104A0A2P6P9V9_ROSCH; Putative transcription factor NAM family
STRINGXP_004300256.11e-111(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67223450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.19e-60NAC domain containing protein 71
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Asahina M,Satoh S
    Molecular and physiological mechanisms regulating tissue reunion in incised plant tissues.
    J. Plant Res., 2015. 128(3): p. 381-8
    [PMID:25736731]
  3. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]