PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000469.1.g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Nin-like
Protein Properties Length: 351aa    MW: 40580.1 Da    PI: 4.7763
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000469.1.g00007.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.41.1e-26177226352
                          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                     k +s e++s+yF++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk++sl
  FANhyb_rscf00000469.1.g00007.1 177 KLLSRETISQYFYMPITQAAKELNVGLTLLKKRCRELGIRRWPHRKLTSL 226
                                     67899******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.848162246IPR003035RWP-RK domain
PfamPF020425.3E-22179226IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MSNPNWVVSN ENPFSFANQF SPADFSGYAP VLDWENEVQP MVQDYSFVDA LPFMETCLNL  60
HDHDPLYSSL DIQPIRSLFQ DSERVGDDVL FGDNANETEN VVHNEVFASG FEHPNHDHDQ  120
QEQQQQEKQQ PILLLTSNED QNGGDREHVG EERKHKKRCM RDEVKSGSST RSYSSSKLLS  180
RETISQYFYM PITQAAKELN VGLTLLKKRC RELGIRRWPH RKLTSLQTLI RNIQVNIQEL  240
GKEEDDNNEE KLRNAIELLE REKKLMEEAP DMQLEDHTKR LRQACFKANY KKRKIMGMNL  300
IDYPPHSSNF SFVDNRGGKS MAIIDNGEDE EDEEIKSLLS DSFSSSVSMM I
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011465692.10.0PREDICTED: protein RKD2
STRINGVIT_17s0000g06250.t011e-67(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.18e-46RWP-RK domain-containing protein