PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000452.1.g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HD-ZIP
Protein Properties Length: 865aa    MW: 94066.6 Da    PI: 6.4714
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000452.1.g00006.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.63.4e-21111166156
                                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                     +++ +++t++q++eLe+lF+++++p++++r eL+++l+L++rqVk+WFqNrR+++k
  FANhyb_rscf00000452.1.g00006.1 111 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLNLETRQVKFWFQNRRTQMK 166
                                     688999***********************************************999 PP

2START206.79.3e-653155371206
                                     HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT CS
                           START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqW 72 
                                     ela++a++elvk+a+ +ep+W+++   e +n +e++++f++  +     + +ea+r++g+v+ ++  lve+l+d++ +W
  FANhyb_rscf00000452.1.g00006.1 315 ELALAAMDELVKLAQTDEPLWSLEGgrEVLNHEEYMRSFTPCIGlkpngFVTEASRETGMVIINSLALVETLMDSN-RW 392
                                     5899********************999*************999899999***************************.** PP

                                     -TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-T CS
                           START  73 detla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppess 140
                                      e+++    + +t++vissg      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvSvd  ++++  +
  FANhyb_rscf00000452.1.g00006.1 393 LEMFPcmiaRTSTTDVISSGmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSVDTIRDNSGAP 471
                                     ****************************************************************************9** PP

                                     TSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                           START 141 svvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                      ++ +++lpSg+++++++ng+skvtwveh++++++++h l+r+l++sg+ +ga++wvatlqrqc++
  FANhyb_rscf00000452.1.g00006.1 472 TFANCRRLPSGCVVQDMPNGYSKVTWVEHAEYDESQVHHLYRPLLSSGMGFGAQRWVATLQRQCQC 537
                                     ****************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.3E-2197168IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-2297168IPR009057Homeodomain-like
PROSITE profilePS5007118.058108168IPR001356Homeobox domain
SMARTSM003893.6E-19109172IPR001356Homeobox domain
CDDcd000861.29E-19111168No hitNo description
PfamPF000468.6E-19111166IPR001356Homeobox domain
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
PROSITE profilePS5084843.593306540IPR002913START domain
SuperFamilySSF559613.3E-33310537No hitNo description
CDDcd088754.29E-124312536No hitNo description
SMARTSM002348.3E-48315537IPR002913START domain
PfamPF018525.5E-57315537IPR002913START domain
SuperFamilySSF559612.51E-18558669No hitNo description
SuperFamilySSF559612.51E-18723792No hitNo description
SuperFamilySSF559612.51E-18819851No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 865 aa     Download sequence    Send to blast
MSFGGFLDNS TGSSGGARIV ADIPYNHHPH HNANHTSMPS SAIAQPRLQT NADGGGDAAR  60
MAENFEGNNN VGGRRSREEE NEISRSGSDN MDGAGSGDEG DAADNSNPRK KKRYHRHTPQ  120
QIQELEALFK ECPHPDEKQR LELSRRLNLE TRQVKFWFQN RRTQMKTQLE RHENSLLRQE  180
NDKLRAENMS IRDAMRNPIC TNCGGPAMIG DISIEEQHLR IDNARLKDEL DRVCALAGKF  240
LGRPISSLGP SMGPPLPSSA LELGVGNNGF GGMSSVSTTM PLGPDFGAGL GGGMPLVAHT  300
RPVAGGLDER TMFLELALAA MDELVKLAQT DEPLWSLEGG REVLNHEEYM RSFTPCIGLK  360
PNGFVTEASR ETGMVIINSL ALVETLMDSN RWLEMFPCMI ARTSTTDVIS SGMGGTRNGA  420
LQLMHAELQV LSPLVPVREV NFLRFCKQHA EGVWAVVDVS VDTIRDNSGA PTFANCRRLP  480
SGCVVQDMPN GYSKVTWVEH AEYDESQVHH LYRPLLSSGM GFGAQRWVAT LQRQCQCLAI  540
LMSSTVPARD HANTITQSGR KSMLKLAQRM TDNFCAGVCA STVHKWNKLN AGNVDEDVRY  600
MTRESMDDPG EPPGIVLSAA TSVWLPVSPQ RLFNFLRDER LRSEWDILSN GGPMQEMAHI  660
AKGQDQGNCV SLLRARVSFL NFLSLNYLVQ YDACVPGRES EVKMAKRDGV FVWLCVGIMG  720
KVKVKWGEKG QAMNANQNSM LILQETCIDA AGSLVVYAPV DIPAMHVVMN GGDSAYVALL  780
PSGFAIVPDG PGSRGPGGAE GKAGQGGSNG NGGEARVSGS LLTMTFQILV NSLPSAKLTV  840
ESVETVNNLI SCTVQKIKGA LQCES
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004306832.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A2P6SGK80.0A0A2P6SGK8_ROSCH; Putative transcription factor & lipid binding Homobox-WOX family
STRINGXP_004306832.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]