PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000399.1.g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 287aa    MW: 32928 Da    PI: 8.5484
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000399.1.g00005.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.92.3e-5491341128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhPtdeel+v+yLk+++ +k++++ ++i+evdiyk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nrat 
  FANhyb_rscf00000399.1.g00005.1   9 LPPGFRFHPTDEELIVYYLKNQAISKPCPV-SIIPEVDIYKFDPWQLPEKAEFGENEWYFFSPRDRKYPNGVRPNRATV 86 
                                     79****************************.89***************99999************************** PP

                             NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     sgyWkatg+dk+++s  ++ vg+kk Lvfykgr pkg ktdW+mheyrl
  FANhyb_rscf00000399.1.g00005.1  87 SGYWKATGTDKAIHS-ASKYVGVKKALVFYKGRPPKGIKTDWIMHEYRL 134
                                     ***************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.15E-665161IPR003441NAC domain
PROSITE profilePS5100561.3139161IPR003441NAC domain
PfamPF023654.8E-2710134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MEANSSSGLP PGFRFHPTDE ELIVYYLKNQ AISKPCPVSI IPEVDIYKFD PWQLPEKAEF  60
GENEWYFFSP RDRKYPNGVR PNRATVSGYW KATGTDKAIH SASKYVGVKK ALVFYKGRPP  120
KGIKTDWIMH EYRLSDSKRQ ATKQLGSMRL DDWVLCRIYK KRHVNKAYMD PKLEDSSPQM  180
DHFTAANDVK EEQGVNFPRN FSFSSFLDMD YLGPISQLLN ENPTYDFQNM LATNAGLNGQ  240
TFQFGDQIPY QSADSGKFQV MNQSNSTLNQ PLFVNPAYNN NMNGLNH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-70916217166NO APICAL MERISTEM PROTEIN
1ut4_B2e-70916217166NO APICAL MERISTEM PROTEIN
1ut7_A2e-70916217166NO APICAL MERISTEM PROTEIN
1ut7_B2e-70916217166NO APICAL MERISTEM PROTEIN
3swm_A3e-70916220169NAC domain-containing protein 19
3swm_B3e-70916220169NAC domain-containing protein 19
3swm_C3e-70916220169NAC domain-containing protein 19
3swm_D3e-70916220169NAC domain-containing protein 19
3swp_A3e-70916220169NAC domain-containing protein 19
3swp_B3e-70916220169NAC domain-containing protein 19
3swp_C3e-70916220169NAC domain-containing protein 19
3swp_D3e-70916220169NAC domain-containing protein 19
4dul_A2e-70916217166NAC domain-containing protein 19
4dul_B2e-70916217166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004297288.10.0PREDICTED: NAC transcription factor 29-like
SwissprotK4BWV21e-119NAP1_SOLLC; NAC domain-containing protein 1
TrEMBLA0A2P6R2T40.0A0A2P6R2T4_ROSCH; Putative transcription factor NAM family
STRINGXP_004297288.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41033262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-117NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]