PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000358.1.g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Nin-like
Protein Properties Length: 152aa    MW: 17694.6 Da    PI: 10.0847
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000358.1.g00004.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK76.92.3e-242777252
                          RWP-RK  2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                                     k +sle++s+yF++p+++AA e++v++T+LK++CR++ IkRWP Rk++sl
  FANhyb_rscf00000358.1.g00004.1 27 AKMLSLETISQYFYMPMAQAAEEMNVSVTTLKKRCRELRIKRWPNRKLNSL 77
                                    5889*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.5521797IPR003035RWP-RK domain
PfamPF020428.2E-223077IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MSSNIINTTP CNTEDRSGAS SSSKSRAKML SLETISQYFY MPMAQAAEEM NVSVTTLKKR  60
CRELRIKRWP NRKLNSLKNL EKSIQESGKN EEELELLEKE RKLVEEVPDL QLEEKTKRLR  120
RLIFKRPKAA PDQKQLLLDS LVIGLLYVFR FC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004305085.11e-47PREDICTED: protein RKD1-like
SwissprotQ9M9U94e-32RKD1_ARATH; Protein RKD1
TrEMBLF6GT762e-37F6GT76_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g06250.t017e-37(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3408022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-22RWP-RK domain-containing protein