PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000355.1.g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 340aa    MW: 38761.3 Da    PI: 6.5181
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000355.1.g00002.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.97.8e-57161421129
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhPtdeel+++yL +kv ++ +++ ++i evd++k+ePwdLp ++k +ekewyfF+ rd+ky+tg r+nrat+
  FANhyb_rscf00000355.1.g00002.1  16 LPPGFRFHPTDEELISHYLSPKVLDSAFTA-RAIGEVDLNKCEPWDLPWRAKMGEKEWYFFCVRDRKYPTGLRTNRATE 93 
                                     79*************************999.89***************888999************************* PP

                             NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                     +gyWkatgkdke+++  + lvg+kktLvfykgrapkgekt+Wvmheyrle
  FANhyb_rscf00000355.1.g00002.1  94 AGYWKATGKDKEIYK-AKVLVGMKKTLVFYKGRAPKGEKTNWVMHEYRLE 142
                                     **************9.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6412166IPR003441NAC domain
PROSITE profilePS5100560.01716166IPR003441NAC domain
PfamPF023654.3E-3017141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MENVSAFINE DEQMELPPGF RFHPTDEELI SHYLSPKVLD SAFTARAIGE VDLNKCEPWD  60
LPWRAKMGEK EWYFFCVRDR KYPTGLRTNR ATEAGYWKAT GKDKEIYKAK VLVGMKKTLV  120
FYKGRAPKGE KTNWVMHEYR LEGKYSAYNL PKTAKNEWVI CRIFQKCSGG KKTHISGLVR  180
ESPYGNDQFR PSLLPPLMDS PPYNNSDTRT TTVGGETSHV SCFSDPMEDQ KTQDDIIDSF  240
NNNNNNDNMS SSNNSHLLVS SSSFPFNSSV QNSYFSNQIP PNTGNMQYPD SGFMQDQSIM  300
RLLTEPQAPI LKRNSSNYLG GQDVPSYSAA PMDFDSIWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-541317214171NO APICAL MERISTEM PROTEIN
1ut4_B6e-541317214171NO APICAL MERISTEM PROTEIN
1ut7_A6e-541317214171NO APICAL MERISTEM PROTEIN
1ut7_B6e-541317214171NO APICAL MERISTEM PROTEIN
3swm_A8e-541317217174NAC domain-containing protein 19
3swm_B8e-541317217174NAC domain-containing protein 19
3swm_C8e-541317217174NAC domain-containing protein 19
3swm_D8e-541317217174NAC domain-containing protein 19
3swp_A8e-541317217174NAC domain-containing protein 19
3swp_B8e-541317217174NAC domain-containing protein 19
3swp_C8e-541317217174NAC domain-containing protein 19
3swp_D8e-541317217174NAC domain-containing protein 19
4dul_A6e-541317214171NAC domain-containing protein 19
4dul_B6e-541317214171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004304286.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ21e-123NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A2P6S4B40.0A0A2P6S4B4_ROSCH; Putative transcription factor NAM family
TrEMBLU5I0250.0U5I025_ROSHC; NAC domain protein 100
STRINGXP_004304286.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-115NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]