PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000319.1.g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HD-ZIP
Protein Properties Length: 310aa    MW: 34802.5 Da    PI: 6.8697
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000319.1.g00005.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.52.3e-1883135456
                                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                     + +++ eq+++Le+ Fe+ +++  e++ +LAk lgL+ rqV +WFqNrRa++k
  FANhyb_rscf00000319.1.g00005.1  83 KKRLNLEQVKTLEKSFEMGNKLEPERKLQLAKALGLQPRQVAIWFQNRRARWK 135
                                     4568889*********************************************9 PP

2HD-ZIP_I/II130.56.5e-4281171191
                     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeener 79 
                                     ekk+rl+ eqvk+LE+sFe+ +kLeperK +la++Lglqprqva+WFqnrRAR+ktkqlEkdy++Lk+++dalk++n++
  FANhyb_rscf00000319.1.g00005.1  81 EKKKRLNLEQVKTLEKSFEMGNKLEPERKLQLAKALGLQPRQVAIWFQNRRARWKTKQLEKDYDVLKKKFDALKADNDA 159
                                     69***************************************************************************** PP

                     HD-ZIP_I/II  80 LekeveeLreel 91 
                                     L++++++L++el
  FANhyb_rscf00000319.1.g00005.1 160 LQSHNKKLQSEL 171
                                     *********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.91E-1979139IPR009057Homeodomain-like
SMARTSM003898.7E-1880141IPR001356Homeobox domain
PROSITE profilePS5007116.63381137IPR001356Homeobox domain
CDDcd000863.41E-1782138No hitNo description
PfamPF000461.2E-1583135IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-1985145IPR009057Homeodomain-like
PRINTSPR000311.3E-5108117IPR000047Helix-turn-helix motif
PROSITE patternPS000270112135IPR017970Homeobox, conserved site
PRINTSPR000311.3E-5117133IPR000047Helix-turn-helix motif
PfamPF021832.1E-14137176IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MFQTHEDPDL HLSAASSSLN NSCPPQHFHG GGGGIPFMMR RSLSFSGVDD KCNHHHYDHQ  60
DLHGGGDQDD LSDDGSQLIG EKKKRLNLEQ VKTLEKSFEM GNKLEPERKL QLAKALGLQP  120
RQVAIWFQNR RARWKTKQLE KDYDVLKKKF DALKADNDAL QSHNKKLQSE LLAIKGSKDS  180
NFEGGLSNNM KKETDQGSWS NGSTDDNSSD HINLDMSRST TPAATSPQSN TQITNGSKNL  240
FPSSLCRPPH ASITQLLQGS SRSSDLHCLK VDQMIQDDQT FCTMFNNGSI DQDHQGNFWP  300
WPAEQPHHFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1129137RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004296553.10.0PREDICTED: homeobox-leucine zipper protein ATHB-20-like
SwissprotQ004663e-78HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A2P6S4P30.0A0A2P6S4P3_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004296553.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.11e-69homeobox 3