PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000307.1.g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 118aa    MW: 13061.7 Da    PI: 4.2389
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000307.1.g00012.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26057.15.4e-1825349100
                          DUF260  49 lpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                     lp ++r+da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+ +la++++e
  FANhyb_rscf00000307.1.g00012.1   2 LPVHQRTDAVSSLVYEANARVRDPVYGCVGAISCLQNQVSELQMQLAVAQAE 53 
                                     6889********************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.317154IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-16251IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
ELPVHQRTDA VSSLVYEANA RVRDPVYGCV GAISCLQNQV SELQMQLAVA QAEILCIQMQ  60
QESTVLPSQP IDSCIDNERT YFLNNSLPQY LNFPSSSSSN VIHDSLKMEG IFGHDMVS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011469944.16e-82PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW33e-34LBD12_ARATH; LOB domain-containing protein 12
TrEMBLM5X1C11e-55M5X1C1_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g01880.t013e-51(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-35LBD family protein