PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000255.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 559aa    MW: 63267.2 Da    PI: 8.5143
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000255.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.52.2e-52231521128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     + pGfrFhPtdeelv +yLk+k+++++l++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky++++r+nr+t 
  FANhyb_rscf00000255.1.g00001.1  23 MLPGFRFHPTDEELVGFYLKRKIQQRPLSI-ELIKQLDIYKFDPWDLPKLAASGEKEWYFYCPRDRKYRNSTRPNRVTG 100
                                     579***************************.89***************8888899************************ PP

                             NAM  80 sgyWkatgkdkevlsk...kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     +g+Wkatg+d++++s+   +++ +glkk+Lvfykgra kg+ktdW+mhe+rl
  FANhyb_rscf00000255.1.g00001.1 101 AGFWKATGTDRPIYSSegnSNKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRL 152
                                     ***************96655556***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-5722187IPR003441NAC domain
PROSITE profilePS5100556.5623187IPR003441NAC domain
PfamPF023652.4E-2525152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MDQERSSSGD MSAADQDKID EVMLPGFRFH PTDEELVGFY LKRKIQQRPL SIELIKQLDI  60
YKFDPWDLPK LAASGEKEWY FYCPRDRKYR NSTRPNRVTG AGFWKATGTD RPIYSSEGNS  120
NKCIGLKKSL VFYKGRAAKG VKTDWMMHEF RLPSLTDSSV VPSKRSFMDK IAIPANDSWA  180
ICRIFKKTNT SAHQRAISHH SWVSQTLPEP NTFQDHVLGS SRLGAQTTNT TQYSGNNIII  240
ETQQISTSTT TSTLSPVDNY YANNPYKTLH PSIPCNLKPY HQYFPISNAG DYFNPNFTFS  300
PLENPAAKCS ADISSLLLNM SSSVLGDFGT KLASAESSTT FDFSSTTDSQ EQQCNNGFSS  360
SLTTIPHHEL MQETDDHEHW ESSLQSSSIG FPFMSSLPVI PMNIGGGDAW KSNLTWDSSP  420
CPRFDWAAEM VVDSASSRLT GCLVSTRRKK KHCDSLSRLG RRRKRERKRE RDDGVCVKLR  480
KVAIVDVTKA QTDRGLHHLK TLYTNWKTEE GSVFALSVLL KTKNPECDSE MEDHKKKQSI  540
EEDRPVRVCL VEIYIPHQK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-55111914169NO APICAL MERISTEM PROTEIN
1ut4_B6e-55111914169NO APICAL MERISTEM PROTEIN
1ut7_A6e-55111914169NO APICAL MERISTEM PROTEIN
1ut7_B6e-55111914169NO APICAL MERISTEM PROTEIN
3swm_A7e-55111917172NAC domain-containing protein 19
3swm_B7e-55111917172NAC domain-containing protein 19
3swm_C7e-55111917172NAC domain-containing protein 19
3swm_D7e-55111917172NAC domain-containing protein 19
3swp_A7e-55111917172NAC domain-containing protein 19
3swp_B7e-55111917172NAC domain-containing protein 19
3swp_C7e-55111917172NAC domain-containing protein 19
3swp_D7e-55111917172NAC domain-containing protein 19
4dul_A6e-55111914169NAC domain-containing protein 19
4dul_B6e-55111914169NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1448464KKKHCDSLSRLGRRRKR
2460470RRRKRERKRER
3461469RRKRERKRE
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011463074.10.0PREDICTED: LOW QUALITY PROTEIN: transcription factor JUNGBRUNNEN 1
SwissprotQ9ZVH03e-99FEZ_ARATH; Protein FEZ
TrEMBLA0A2P6R2Y30.0A0A2P6R2Y3_ROSCH; Putative transcription factor NAM family
STRINGXP_008390053.11e-176(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.13e-98NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]