PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000215.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family SBP
Protein Properties Length: 525aa    MW: 57478 Da    PI: 8.3849
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000215.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.28.5e-42141217278
                                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                     Cqv+gC++dls+ k+yh+rhkvCe+hsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q 
  FANhyb_rscf00000215.1.g00001.1 141 CQVHGCNKDLSSSKDYHKRHKVCEAHSKTAKVIVKGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQV 217
                                     **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-33136202IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.411138215IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.11E-38139219IPR004333Transcription factor, SBP-box
PfamPF031103.9E-32141214IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MESWSCSSEG KSFAPDETVS HTDSLARNRS ALMGCDLKIP CTFESQGFGE LGLPEMLGKH  60
LPRSTTSMGS TNPFFREDES SSKLSSSIVE SNSRDYSLFD LKLDAYTSKS SKGASFFSSS  120
ESSTPMKRMR VSGVYSQTAY CQVHGCNKDL SSSKDYHKRH KVCEAHSKTA KVIVKGIEQR  180
FCQQCSRFHL LAEFDDGKRS CRKRLAGHNE RRRKPQVNIH SGRDGSLVFV SPKDQKILAG  240
VPILRGSSFP GTMFTAASFV CQDILPSSIL DAENYRTSDW RRRVKVEGGT QHRPLSGVPE  300
TNGQLHLKPV FSYDIGKHCP PAHVDDTNNL PSGSILSETG SQYPHDMRSL NSGSRSIYNE  360
GALGSEGFND FHTTASTVQQ LSRIPESCCA HSLLSSQSQN STSYASGIPI AHPLVMSVSQ  420
THYNLSQVSD KLCSQGSTSG VSNKFPSSGG PMTISNGRDA NDFGTNGIFQ GSQFLNTKYR  480
LSCDGGTTVD LLQLSSELQR VDDQRHSLQV KQEYDASAAS KVRIM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-281412141184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299282.10.0PREDICTED: squamosa promoter-binding-like protein 18
RefseqXP_011464285.10.0PREDICTED: squamosa promoter-binding-like protein 18
RefseqXP_011464286.10.0PREDICTED: squamosa promoter-binding-like protein 18
RefseqXP_011464287.10.0PREDICTED: squamosa promoter-binding-like protein 18
TrEMBLA0A2P6P3800.0A0A2P6P380_ROSCH; Putative transcription factor SBP family
STRINGXP_004299282.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-48SBP family protein