PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000207.1.g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 723aa    MW: 82428.7 Da    PI: 5.9445
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000207.1.g00009.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.32.5e-5661331128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknra 77 
                                     lppGfrFhPtdeelv +yLk+k++g+k+el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nra
  FANhyb_rscf00000207.1.g00009.1   6 LPPGFRFHPTDEELVAYYLKRKINGRKIEL-EIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRA 83 
                                     79****************************.99***************6434555777********************* PP

                             NAM  78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     tk+gyWkatgkd++v s ++++vg+kktLv+y+grap+g +tdWvmheyrl
  FANhyb_rscf00000207.1.g00009.1  84 TKAGYWKATGKDRKVNS-QTRAVGMKKTLVYYRGRAPHGIRTDWVMHEYRL 133
                                     *****************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.2E-644156IPR003441NAC domain
PROSITE profilePS5100561.8716156IPR003441NAC domain
PfamPF023658.0E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 723 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKING RKIELEIIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS QTRAVGMKKT LVYYRGRAPH  120
GIRTDWVMHE YRLDQRECET AQGLQDAYAL CRIFKKTATG PKIGEHYGST SGTTNYQLMT  180
SDHHSSSVEL YSDSRCDHQD FESSRYNNQM AMNNTPCSSN MVQTSSSSSL DHMGRKRDGK  240
WSQFLSKDAF NSFSSFPNQG AIPYPPSKVS IVTLNLLLLY VLSLILRPMH THTCDTSLVP  300
TVDIALECAR LQHRLTLPPL EVEDFPHVGF TDFKNLQYSD PGLEGTGTET DALQEILSVA  360
HVSQEMINQS NNFADQTWAT ANYAPGANDF SFMVDRDAHY NQIITTHHDM NPMRYVDKPW  420
ENSYIRSIEI GDLEDDDFRT DNTTENLRWI GMSDKDLEKS FTEEHKIVPI ENIASFRRED  480
HGHQVEGDQT AHHIDMIKEF NDGETNDFSL GFINDDPDEN FLQDGNIETD YSSSPSFEVI  540
EEIQVNHGMF VSTRQVADTF FHQIMPSETV KVHLNPVLVH SYLVEKVDDA QQNSKNTRGS  600
FFEMFKEFVM EKFVGVIRSM NPWRKMASAM VFAVTLLLMH TIYVGEHLED EKLRDAFTAT  660
TTTAIVVEEK GSSNIISKKK REVCLVNIRG GSSCSLFLKK IGIFLTVSLA LCTVWANHNI  720
ITS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-57215611168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004289565.10.0PREDICTED: NAC domain-containing protein 86 isoform X2
TrEMBLA0A2P6RFU40.0A0A2P6RFU4_ROSCH; Putative transcription factor NAM family
STRINGXP_004289565.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44213460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-154NAC domain containing protein 28