PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000190.1.g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 653aa    MW: 71354 Da    PI: 6.5602
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000190.1.g00003.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM63.75.8e-2024881128
                             NAM  81 gyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     gyWkatg+d++v++ ++++vg+kktLvf++grap+g++t+Wvmheyrl
  FANhyb_rscf00000190.1.g00003.1   2 GYWKATGNDRPVKH-NNKTVGMKKTLVFHSGRAPDGKRTNWVMHEYRL 48 
                                     9*************.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100528.365189IPR003441NAC domain
SuperFamilySSF1019416.8E-23289IPR003441NAC domain
PfamPF023655.2E-9248IPR003441NAC domain
SuperFamilySSF511208.37E-12133270IPR011049Serralysin-like metalloprotease, C-terminal
Gene3DG3DSA:2.150.10.101.9E-12133297IPR011049Serralysin-like metalloprotease, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 653 aa     Download sequence    Send to blast
MGYWKATGND RPVKHNNKTV GMKKTLVFHS GRAPDGKRTN WVMHEYRLVD TEMERPGNGV  60
PQVRHWPNFV SLHLSMKLDA YVLCRVFHKS NIGPPNGHRY APFVEEEWDD EKLTFVPGEV  120
ARDETSAAHD SVGNHRDVVM LGNGHDFVGG NGHDSVGGNH YNVVMVGNGH DSAVGGNHHD  180
FIMVGNGHHS VVGGNHRDVV MAGNGHDSVV GGNCRDVVVI GNGRDSVVGG PIPDAVVGAN  240
GCHALVFGNG RDTVAGNACD AAVGGNGHAA AFIEQDVHDA VDIDQKDHVS MNNKMEVDGH  300
GTTKEGNVHG SIGGNGLKGA TAVNYIVQVL SRLDILDQFY KIVLQHSFQK SNINYKQGCV  360
QYGIRKCRSG YCTNLLILLA GKMVLPSLGF IGYASALRCG IRLFCQWDGS VTEWRINDPV  420
AMGNWKTSLI GCSYQDTQTI SNALLSATEL PKEDPTVLVP CKSEKLDDDP VTCVINREER  480
LDDYPSPLTD DPQPLLSLFN QQPGILRQYK RRRHNESNSN RSNASEISSG MTHDPCSSTT  540
TTASTEASVT ASTKRNFLSA LVEFQLLESL EPKDKTPVAP PEFNAALHNS SVPSSCLKFI  600
ESLQNEIHKI SIEKETLKFE MLSSQAVINI LQSRIDLLNK ENEELKRNAR EAE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-1729194170Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307019.10.0PREDICTED: uncharacterized protein LOC101300663
TrEMBLA0A2P6SCG40.0A0A2P6SCG4_ROSCH; Putative transcription factor NAM family
STRINGXP_004307019.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF81893241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.14e-42NAC domain containing protein 52