PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000189.1.g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 332aa    MW: 38224.6 Da    PI: 6.6116
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000189.1.g00004.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1782.5e-5571361129
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknr 76 
                                     +ppGfrFhPtdeelv++yL+kkv++++++l +vik+vd+yk+ePwdL++  ++ ++e+ +wyfFs++dkky+tg+r+nr
  FANhyb_rscf00000189.1.g00004.1   7 VPPGFRFHPTDEELVDYYLRKKVTARRIDL-DVIKDVDLYKIEPWDLQElcRIGTDEQsDWYFFSHKDKKYPTGTRTNR 84 
                                     69****************************.9***************954555554445******************** PP

                             NAM  77 atksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                     at++g+Wkatg+dk++++ k+ l+g++ktLvfykgrap+g+k+dW+mheyrle
  FANhyb_rscf00000189.1.g00004.1  85 ATAAGFWKATGRDKAIYA-KHDLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                                     ******************.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.12E-585175IPR003441NAC domain
PROSITE profilePS5100558.5227175IPR003441NAC domain
PfamPF023655.4E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MNTFSHVPPG FRFHPTDEEL VDYYLRKKVT ARRIDLDVIK DVDLYKIEPW DLQELCRIGT  60
DEQSDWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YAKHDLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN GAPQASTIIT LTNFLHCSTS NAQEEGWVVC RVFKKKLPSM  180
RRMSEHESPC WYDEHVSFMP DLDSPNHNNS NSSMNNQMAY HGHFPNYPCK KELDHLPFQH  240
HVPNEHFFQL PLLDSPKLLL QSSSSAAVSS NSMTAAAAYS IDINQNFHAV YGNNSNELQA  300
VDDDQLTDWR VLDKFVASQL SQDDVSKGNS YS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-49617614169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024197032.10.0NAC domain-containing protein 7-like
SwissprotQ9FWX21e-130NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A2P6SMC30.0A0A2P6SMC3_ROSCH; Putative transcription factor NAM family
STRINGEMJ213311e-180(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-110NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]