PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000163.1.g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 307aa    MW: 34438.2 Da    PI: 5.017
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000163.1.g00004.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.95.9e-51171431128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknrat 78 
                                     + pGfrF+Ptdeel+++yLk+k+e+ + ++ evi+evdi+++ePwdLp k+v ++e+ew+fFs+r +ky++g++++rat
  FANhyb_rscf00000163.1.g00004.1  17 MFPGFRFSPTDEELISYYLKNKLESPEKSV-EVISEVDICNFEPWDLPaKSVIQSENEWFFFSPRGRKYPNGSQSRRAT 94 
                                     579************************998.99***************667777899********************** PP

                             NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     +sgyWkatgk+++v+s +++++g+k+tLvf+ grapkge+t+W+mhey +
  FANhyb_rscf00000163.1.g00004.1  95 ESGYWKATGKERNVKS-SSSVIGTKRTLVFHIGRAPKGERTEWIMHEYCM 143
                                     ****************.999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-5710159IPR003441NAC domain
PROSITE profilePS5100554.38117160IPR003441NAC domain
PfamPF023652.9E-2619142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MGGISKEAQL SIAASSMFPG FRFSPTDEEL ISYYLKNKLE SPEKSVEVIS EVDICNFEPW  60
DLPAKSVIQS ENEWFFFSPR GRKYPNGSQS RRATESGYWK ATGKERNVKS SSSVIGTKRT  120
LVFHIGRAPK GERTEWIMHE YCMLNDKSQD SMVVCRLRKN SEFHLNDTTN RGSSSQSPLS  180
AQHNSENVVS EIGTDQGEKA IDCNSKKSTS SYDSHSIEQM DSASDSYQKL TPEVTQMESS  240
GHQKRSYDDD FFADILKDDI IKLDESSVSV ADNILPVVEN NSEAQQESMP AVVSQAIPFQ  300
VTKMFSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-471615916164NO APICAL MERISTEM PROTEIN
1ut4_B8e-471615916164NO APICAL MERISTEM PROTEIN
1ut7_A8e-471615916164NO APICAL MERISTEM PROTEIN
1ut7_B8e-471615916164NO APICAL MERISTEM PROTEIN
3swm_A8e-471615919167NAC domain-containing protein 19
3swm_B8e-471615919167NAC domain-containing protein 19
3swm_C8e-471615919167NAC domain-containing protein 19
3swm_D8e-471615919167NAC domain-containing protein 19
3swp_A8e-471615919167NAC domain-containing protein 19
3swp_B8e-471615919167NAC domain-containing protein 19
3swp_C8e-471615919167NAC domain-containing protein 19
3swp_D8e-471615919167NAC domain-containing protein 19
4dul_A8e-471615916164NAC domain-containing protein 19
4dul_B8e-471615916164NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in plant cell division. {ECO:0000269|PubMed:16803883}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011459418.10.0PREDICTED: NAC domain-containing protein 89 isoform X1
SwissprotQ94F583e-92NAC89_ARATH; NAC domain-containing protein 89
TrEMBLA0A498IMV01e-174A0A498IMV0_MALDO; Uncharacterized protein
STRINGXP_004291689.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73153346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.11e-85NTM1-like 8
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]