PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000153.1.g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HB-other
Protein Properties Length: 1164aa    MW: 129226 Da    PI: 7.7576
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000153.1.g00012.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.66.5e-06125181157
                                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                                     +r+R  ++++ ++ ++++F  +  ++++e +eL++  g++ +qV+ +F  +R + +k
  FANhyb_rscf00000153.1.g00012.1 125 KRPRDLLNPKAIKYMQSVFSVKDAITKKESRELSALFGVSVSQVREFFNTQRSRVRK 181
                                     799**************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.863122182IPR001356Homeobox domain
SuperFamilySSF466895.13E-6124184IPR009057Homeodomain-like
SMARTSM003892.2E-4124186IPR001356Homeobox domain
CDDcd000861.96E-4125181No hitNo description
Gene3DG3DSA:1.10.10.601.8E-5125189IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1164 aa     Download sequence    Send to blast
MWVLLTYSAP TLFLHPLRFV KALTLTLSPS VIKVHLLCFP ILHALTFPNS QFQASRSSPA  60
MEDPSKLEIG NSVVSFHKFV DSQRQLFHSQ IDELQKFVVT QCKLTGANPL SQEMAAGALS  120
INIGKRPRDL LNPKAIKYMQ SVFSVKDAIT KKESRELSAL FGVSVSQVRE FFNTQRSRVR  180
KIVQLSREKA IRSTEHKGLL EGVPTSFDPL IPLNPVPLNT IGPSNVNPLP LNTIGPSDVN  240
LLPLNTIGPS DVNPLPLNTI GPSNSNPLPL NTVGPSNVED APSCSTQDDT PPGLDDVDKH  300
FVENIFNLMR KEETFSGQVK VLELILRIQN SSVLCWFLTK GGVMILVTWL TQAADEEQTS  360
VILVILKVLC HLPLSKALPA HIIDEAIGDD PWNSNGDVHE NILALPFESA DRLRKSESSE  420
PMKLLTASSD DSNKKHILGV SSSRILHFEF VIVLSQVMYY ISRNLVTEFR GRRKVQLVEQ  480
PGQKTAGRSS QAARATPVSQ ARPMSVDDIQ KAKLRAQYMQ SKYGKSASSN ENKEVKAEGV  540
NKLPVSQAST LPVVYIVPVW SSIEESKKPA TLPFKERETP DMSVQSITSF QPMAPKLKTD  600
IKEHIWEKCR RVQVPWKTPP DKIEQHWPER RLILIRFGHL FSEIDPLPVL SNIINFFFTP  660
FPFLSAEIKL NPEWRVGGGE NGKEMEVQKN RNHREQETIY KTLKEIPPNP KEPWDIEMDY  720
DDSLTPVIPT EQPPDTDCTE TQPSHRQEVN NAAETLVPPP QGVNSVVSPP TNTASSTAEP  780
DLELLAVLLK NPELVFALTS GQAANLSSED TVKLLDMIKA GGAGFAGSLN GLASKMEEKV  840
EVSLPSPTPS RNPGTVWPSM KQVANFELGG GLGLLSGWRP EATRNAFSQQ NSMQNRVSPG  900
YSSPAMVANN SVLSQLPSAL TSPLPQRLSG AQQAVPAYSP EHVHQIPHST TVPSHLQHNY  960
SNMAVPSVWG ESTSNRKPGP LYNSYNVAAE RQPNSLPPPF LSTLTQQQRH SPQPLQQQTR  1020
YSESHYSESP QYSESPYFSK PPTVKQGPPL SDSWRSGRQG LPSNYHYLEN QNQYYNAPPS  1080
YGGGPLQQQP QLRSGPPYEG NEFVNNGGGF ESWSPPEDSP ARNAEYNMYG RNAYRPVERS  1140
RQTQTPGYRD YSRQGQTWPD RGRH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011470994.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
TrEMBLA0A2P6PWM10.0A0A2P6PWM1_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004309678.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-172HB-other family protein