PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000139.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 374aa    MW: 42475.3 Da    PI: 9.7004
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000139.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.56.4e-54251531129
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhPtdeel+ +yL +kv ++++++ ++i++vd++k+ePw+Lp+k+k +ekewy Fs rdkky+tg r+nrat+
  FANhyb_rscf00000139.1.g00001.1  25 LPPGFRFHPTDEELIGYYLLRKVMDSNFTC-RAITQVDLNKCEPWQLPEKAKMGEKEWYLFSLRDKKYPTGIRTNRATE 102
                                     79***************************9.89***************99999************************** PP

                             NAM  80 sgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                                     +gyWkatgkd+e++s+ +g+l g++ktLvfy+grap+g k++Wvmheyrle
  FANhyb_rscf00000139.1.g00001.1 103 AGYWKATGKDREIYSSkTGSLLGMRKTLVFYRGRAPNGMKSNWVMHEYRLE 153
                                     **************9867888****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-6116176IPR003441NAC domain
PROSITE profilePS5100557.24425176IPR003441NAC domain
PfamPF023652.2E-2726152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MELGFSPNLR PNQMELMINL EDSQLPPGFR FHPTDEELIG YYLLRKVMDS NFTCRAITQV  60
DLNKCEPWQL PEKAKMGEKE WYLFSLRDKK YPTGIRTNRA TEAGYWKATG KDREIYSSKT  120
GSLLGMRKTL VFYRGRAPNG MKSNWVMHEY RLECRFAYRH LLRNSQEWVI SRVFQKFKKS  180
NGPECKKVRM IAEPSSPAFS SVSLPLLFDS SPYFSNGNAN SLTNRDSCSH DNRTPRDHVS  240
CFSTSANTAT FNHLMTSSDL APPPKPPTTS FHGFGGLSDF PSLRSLQENL QLPFFPQGML  300
PHQPPYSSTS GSFDLGNWSS PGNSIFQDRH SIATKKDKIL SIVMIVLAVF SNVVAIYSDA  360
YALFKNAKTP SPRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-492017612165NO APICAL MERISTEM PROTEIN
1ut4_B3e-492017612165NO APICAL MERISTEM PROTEIN
1ut7_A3e-492017612165NO APICAL MERISTEM PROTEIN
1ut7_B3e-492017612165NO APICAL MERISTEM PROTEIN
3swm_A3e-492017615168NAC domain-containing protein 19
3swm_B3e-492017615168NAC domain-containing protein 19
3swm_C3e-492017615168NAC domain-containing protein 19
3swm_D3e-492017615168NAC domain-containing protein 19
3swp_A3e-492017615168NAC domain-containing protein 19
3swp_B3e-492017615168NAC domain-containing protein 19
3swp_C3e-492017615168NAC domain-containing protein 19
3swp_D3e-492017615168NAC domain-containing protein 19
4dul_A3e-492017612165NAC domain-containing protein 19
4dul_B3e-492017612165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Controls leaf margin development and required for leaf serration. Involved in axillary meristem initiation and separation of the meristem from the main stem. Regulates the phyllotaxy throughout the plant development. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM and SYD, at the chromatin level, and conferring a very specific spatial expression pattern. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004304985.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 2-like
SwissprotO040174e-87NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLA0A2P6QAJ91e-168A0A2P6QAJ9_ROSCH; Putative transcription factor NAM family
STRINGXP_004304985.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36893463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.12e-89NAC family protein
Publications ? help Back to Top
  1. Wang YX
    Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
    Mol. Biol. Rep., 2013. 40(11): p. 6451-8
    [PMID:24057250]
  2. Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M
    The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development.
    Front Plant Sci, 2014. 5: p. 165
    [PMID:24817871]
  3. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  4. Du Q,Wang H
    The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
    Plant Signal Behav, 2015. 10(10): p. e1078955
    [PMID:26340415]
  5. Vialette-Guiraud AC, et al.
    A Conserved Role for the NAM/miR164 Developmental Module Reveals a Common Mechanism Underlying Carpel Margin Fusion in Monocarpous and Syncarpous Eurosids.
    Front Plant Sci, 2015. 6: p. 1239
    [PMID:26793217]
  6. Cui X, et al.
    REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis.
    Nat. Genet., 2016. 48(6): p. 694-9
    [PMID:27111035]
  7. Blein T,Pautot V,Laufs P
    Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection.
    Plants (Basel), 2013. 2(2): p. 230-47
    [PMID:27137374]
  8. Biot E, et al.
    Multiscale quantification of morphodynamics: MorphoLeaf software for 2D shape analysis.
    Development, 2016. 143(18): p. 3417-28
    [PMID:27387872]
  9. Zheng M, et al.
    Chloroplast Translation Initiation Factors Regulate Leaf Variegation and Development.
    Plant Physiol., 2016. 172(2): p. 1117-1130
    [PMID:27535792]
  10. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  11. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  12. González-Carranza ZH, et al.
    HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression.
    PLoS ONE, 2017. 12(9): p. e0185106
    [PMID:28934292]
  13. Wilson-Sánchez D,Martínez-López S,Navarro-Cartagena S,Jover-Gil S,Micol JL
    Members of the DEAL subfamily of the DUF1218 gene family are required for bilateral symmetry but not for dorsoventrality in Arabidopsis leaves.
    New Phytol., 2018. 217(3): p. 1307-1321
    [PMID:29139551]
  14. Gonçalves B, et al.
    GDP-L-fucose is required for boundary definition in plants.
    J. Exp. Bot., 2017. 68(21-22): p. 5801-5811
    [PMID:29186469]
  15. Sha S, et al.
    To be serrate or pinnate: diverse leaf forms of yarrows (Achillea) are linked to differential expression patterns of NAM genes.
    Ann. Bot., 2018. 121(2): p. 255-266
    [PMID:29267935]
  16. Maugarny-Calès A, et al.
    Dissecting the pathways coordinating patterning and growth by plant boundary domains.
    PLoS Genet., 2019. 15(1): p. e1007913
    [PMID:30677017]