PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000125.1.g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 300aa    MW: 33656.6 Da    PI: 5.6047
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000125.1.g00005.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.93.9e-39241231100
                          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgv 79 
                                     aCaaCk++rr+C+kdC lapyfpa+q k+f+n+h+l+G+sn++k+lk   + ++e+am+s++ye+++ra+ Pv G++g+
  FANhyb_rscf00000125.1.g00005.1  24 ACAACKYQRRRCTKDCELAPYFPADQLKQFQNAHRLYGVSNITKILKLSGPGKKEEAMRSIIYESNMRAKFPVTGCMGI 102
                                     7****************************************************************************** PP

                          DUF260  80 ilklqqqleqlkaelallkee 100
                                     i++l+ ql+q+ +el +++++
  FANhyb_rscf00000125.1.g00005.1 103 INQLTFQLQQAYEELRYVRSH 123
                                     ***************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.40623124IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-3624121IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MIIKTVNECA YFPTMTIKGG TSQACAACKY QRRRCTKDCE LAPYFPADQL KQFQNAHRLY  60
GVSNITKILK LSGPGKKEEA MRSIIYESNM RAKFPVTGCM GIINQLTFQL QQAYEELRYV  120
RSHLAICRDQ CQYQYNSPTC PSSQLQLGLQ TNDHEALQLY QQQYQYHQYN SAAGSSGGGG  180
GGMEEYLLNG INGIYIDEND SVVKPLRVQQ FYYGNNNVDA VAVQHNLMTS QGFPIQQEMD  240
VPHDSDDIPF DTIADDRQSY IESKDACESS AESPFKGTQS LEHVSQNDLK SAAAFFSLTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-24201397124LOB family transfactor Ramosa2.1
5ly0_B3e-24201397124LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011466249.10.0PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A2P6S4T11e-179A0A2P6S4T1_ROSCH; Putative transcription factor AS2-LOB family
STRINGXP_004302364.11e-173(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.19e-41LOB domain-containing protein 27