PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000105.1.g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family TALE
Protein Properties Length: 289aa    MW: 32623.7 Da    PI: 6.7232
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000105.1.g00007.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.42.1e-072382712154
                                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                     k +yp+++++++L +++gL+ +q+ +WF N+R +
  FANhyb_rscf00000105.1.g00007.1 238 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 271
                                     468*****************************87 PP

2ELK25.53e-09192213122
                             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                     ELK +L++++++++ ++++E++
  FANhyb_rscf00000105.1.g00007.1 192 ELKIELKQGFKSRIEDVREEIL 213
                                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.7E-182569IPR005540KNOX1
PfamPF037904.9E-172768IPR005540KNOX1
SMARTSM012561.1E-2483138IPR005541KNOX2
PfamPF037914.9E-1886137IPR005541KNOX2
PROSITE profilePS512139.132192212IPR005539ELK domain
PROSITE profilePS5007111.677212275IPR001356Homeobox domain
SuperFamilySSF466893.76E-16214279IPR009057Homeodomain-like
SMARTSM003891.4E-10214279IPR001356Homeobox domain
CDDcd000863.12E-11215276No hitNo description
Gene3DG3DSA:1.10.10.606.6E-25219277IPR009057Homeodomain-like
PfamPF059209.6E-18232271IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MQDSGLGMMG SGGGLSGGGG DDHAHQLKSE IATHPLYEQL LSAHVSCLRV ATPIDQLPLI  60
DAQLSQSHHL LRSYASHHQQ HGHSLSPHER QELDNFLAQY LIVLCSFKEQ LQQHVRVHAV  120
EAVMACREIE STLQALTGVT LGEGTGATMS DDEDDMPTDF SMDQAGSDAH DMMGFGLPTE  180
SERSLMERVR QELKIELKQG FKSRIEDVRE EILRKRRAGK LPGDTTTVLK NWWQQHSKWP  240
YPTEDDKAKL VEETGLQLKQ INNWFINQRK RNWHSNSQSV TSLKSKRKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12215271864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1268288RKRNWHSNSQSVTSLKSKRKR
Functional Description ? help Back to Top
Source Description
UniProtMay be involved in secondary cell wall biosynthesis. {ECO:0000269|PubMed:15980264}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004298727.10.0PREDICTED: homeobox protein knotted-1-like 7
SwissprotQ9FPQ81e-166KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLA0A2P6P7H70.0A0A2P6P7H7_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004298727.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-164KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Srinivasasainagendra V,Page GP,Mehta T,Coulibaly I,Loraine AE
    CressExpress: a tool for large-scale mining of expression data from Arabidopsis.
    Plant Physiol., 2008. 147(3): p. 1004-16
    [PMID:18467456]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. He JB, et al.
    KNAT7 positively regulates xylan biosynthesis by directly activating IRX9 expression in Arabidopsis.
    J Integr Plant Biol, 2018. 60(6): p. 514-528
    [PMID:29393579]