PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000096.1.g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family WOX
Protein Properties Length: 226aa    MW: 25571 Da    PI: 9.4753
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000096.1.g00007.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox665.1e-2188147357
                                     --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                        Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                                     +R+++t+eq+ +Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  FANhyb_rscf00000096.1.g00007.1  88 TRWNPTQEQIGILEMLYRGgMRTPNAQQIEQMTAQLgkygKIEGKNVFYWFQNHKARERQ 147
                                     7*****************99**************************************97 PP

2Wus_type_Homeobox115.82.1e-3788149465
               Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                                     tRW+Pt+eQi iLe+ly+ G+rtPn+++i+++ta+L +yGkie+kNVfyWFQN+kaRerqkq
  FANhyb_rscf00000096.1.g00007.1  88 TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQMTAQLGKYGKIEGKNVFYWFQNHKARERQKQ 149
                                     8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.8E-1281152IPR009057Homeodomain-like
PROSITE profilePS500719.96183148IPR001356Homeobox domain
SMARTSM003892.9E-785152IPR001356Homeobox domain
CDDcd000861.35E-588149No hitNo description
PfamPF000461.1E-1888147IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.8E-889147IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MKVHQFARGL WDSPTTNLEP SLSLGCKRLR PLAPKLSDTA ATTALAPFDL KSFIRPESGP  60
RNKLPSPPHD HEKKDSSPSQ VEMHPGGTRW NPTQEQIGIL EMLYRGGMRT PNAQQIEQMT  120
AQLGKYGKIE GKNVFYWFQN HKARERQKQK RSTLGLTHSP RTPAPVITTT GEVVLEREED  180
SPYKRKCRSW AFDCLTDDSS TITCNNDVVE GDRTLELFPL RPEGMK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291086.21e-168PREDICTED: WUSCHEL-related homeobox 4
SwissprotQ6X7J92e-71WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLA0A2P6Q0M51e-157A0A2P6Q0M5_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004291086.11e-167(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61323452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.17e-74WUSCHEL related homeobox 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]
  3. Guo X, et al.
    Identification of cyst nematode B-type CLE peptides and modulation of the vascular stem cell pathway for feeding cell formation.
    PLoS Pathog., 2017. 13(2): p. e1006142
    [PMID:28158306]
  4. Denis E, et al.
    WOX14 promotes bioactive gibberellin synthesis and vascular cell differentiation in Arabidopsis.
    Plant J., 2017. 90(3): p. 560-572
    [PMID:28218997]
  5. Kucukoglu M,Nilsson J,Zheng B,Chaabouni S,Nilsson O
    WUSCHEL-RELATED HOMEOBOX4 (WOX4)-like genes regulate cambial cell division activity and secondary growth in Populus trees.
    New Phytol., 2017. 215(2): p. 642-657
    [PMID:28609015]
  6. Yamaguchi YL, et al.
    Root-Knot and Cyst Nematodes Activate Procambium-Associated Genes in Arabidopsis Roots.
    Front Plant Sci, 2017. 8: p. 1195
    [PMID:28747918]