PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000078.1.g00011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 270aa    MW: 30578 Da    PI: 4.8693
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000078.1.g00011.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1752.2e-5461331128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknra 77 
                                     lppGfrFhPtdeelv++yLk+k+ g+++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nra
  FANhyb_rscf00000078.1.g00011.1   6 LPPGFRFHPTDEELVNYYLKRKIIGQEIEL-DIIPEVDLYKCEPWELAeKsFLPSRDPEWYFFGPRDRKYPNGFRTNRA 83 
                                     79****************************.99**************84335556888********************* PP

                             NAM  78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     t++gyWk+tgkd++v s +++++g+kktLv+y+grap+g +tdWvmheyrl
  FANhyb_rscf00000078.1.g00011.1  84 TRAGYWKSTGKDRRVSS-QNRAIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 133
                                     ****************9.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-624159IPR003441NAC domain
PROSITE profilePS5100559.7116159IPR003441NAC domain
PfamPF023656.8E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKIIG QEIELDIIPE VDLYKCEPWE LAEKSFLPSR  60
DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVSS QNRAIGMKKT LVYYRGRAPQ  120
GIRTDWVMHE YRLDDKADCL DDTSAGIQDS FALCRVFKKN GICTEIEEQG GQSSSSDVSL  180
LIHERSSQLL AAGGLHYNDH CSTETLSPEN IIPRASSSSC LQDLEEEEKD DSWMQFITDD  240
PWSSSNTTAV NGTTGEVDLS QSHVGVAFTT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-55216011169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299481.10.0PREDICTED: NAC domain-containing protein 86
SwissprotQ9FFI57e-87NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A2P6P1L90.0A0A2P6P1L9_ROSCH; Putative transcription factor NAM family
STRINGXP_004299481.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95643343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-122NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]