PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000066.1.g00023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family ARR-B
Protein Properties Length: 654aa    MW: 72326.8 Da    PI: 6.5176
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000066.1.g00023.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.94.1e-27202255155
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                     kpr++W+ +LH++Fv av++L G ekA+Pk+il+lm+v+gL++e+v+SHLQkYR 
  FANhyb_rscf00000066.1.g00023.1 202 KPRVVWSGDLHRKFVAAVNEL-GVEKAVPKKILDLMDVEGLSRENVASHLQKYRQ 255
                                     79*******************.********************************6 PP

2Response_reg77.93.6e-26161241109
                                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEE CS
                    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivv 77 
                                     vl vdD+p+ ++ l+ +l+k +y +v+++ ++ +ale+l+e++  +Dl++ D++mp+mdG++ll+ +  e  +lp+i++
  FANhyb_rscf00000066.1.g00023.1  16 VLAVDDDPTCLKFLEGLLRKCKY-HVTTTNQAIKALEMLRENRnkYDLVISDVNMPDMDGFKLLELLGLEM-DLPVIML 92 
                                     799********************.***************999889*********************96644.8****** PP

                                     ESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
                    Response_reg  78 tahgeeedalealkaGakdflsKpfdpeelvk 109
                                     +++++ e++ + ++ Ga d+  Kp+  eel +
  FANhyb_rscf00000066.1.g00023.1  93 SGYSDVELVMKGIDHGACDYMLKPVRLEELKN 124
                                     *****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.7E-1491653IPR017053Response regulator B-type, plant
SuperFamilySSF521722.99E-3712137IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.9E-4312153No hitNo description
SMARTSM004482.5E-3314126IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.72815130IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-2316124IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.93E-2817129No hitNo description
Gene3DG3DSA:1.10.10.601.6E-27199259IPR009057Homeodomain-like
PROSITE profilePS5129411.014199258IPR017930Myb domain
SuperFamilySSF466898.24E-18200259IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-23202255IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 654 aa     Download sequence    Send to blast
MTVEDQRDRF PEGMRVLAVD DDPTCLKFLE GLLRKCKYHV TTTNQAIKAL EMLRENRNKY  60
DLVISDVNMP DMDGFKLLEL LGLEMDLPVI MLSGYSDVEL VMKGIDHGAC DYMLKPVRLE  120
ELKNIWQHVV RKKKSETKDQ KKSSNQDKAS NGTGEGVKGA SPTGSSDQNG KLHKKRKDQN  180
RDEEEESEDD EHDTEDSLSQ KKPRVVWSGD LHRKFVAAVN ELGVEKAVPK KILDLMDVEG  240
LSRENVASHL QKYRQYLKKL RGKESPYVRM GLLDGFRDIQ SLRSGRMSSS TLSTYTSGGL  300
LRRLNSPAGL STGGMTSAGL GQPGHSQNLS SYINPFAKLQ PTVPPNQSPH LFQGTPALSK  360
FNPLQQSKCI NHNGKSYPDN DSANYRLSST FQDSGVSSSS LPSDSNFASN PLVLQGIPQQ  420
TNSMGVFGNP TSVKVSFDIG ISGSSNFLDY NRCSENIQGG AQLSSFPSNA LPTSEPFNRG  480
QIHTNNLGVC SSRPQIGNTL NDFSSVSALS APVDELRGNV ENQEGLIGDV VPTLTYMAKQ  540
RWEEHKPGYI HESNQTFSAI TFSGSTLGTD GLVSHKLDQN DAVCNYERNS SLHDRLNGAT  600
PIFVQPSEAG KSSMETKMKP NEDYFLEQTH SPNGFLQNSY ESFDDIMSTI MRRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-23199260263ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011460283.10.0PREDICTED: two-component response regulator ARR12
RefseqXP_011460333.10.0PREDICTED: two-component response regulator ARR12
TrEMBLA0A2P6RIC30.0A0A2P6RIC3_ROSCH; Two-component response regulator
STRINGXP_004287107.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.12e-92response regulator 12