PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000056.1.g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 347aa    MW: 39508 Da    PI: 4.7821
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000056.1.g00008.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.93.1e-5661331128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknra 77 
                                     lppGfrFhPtdeelv +yL +k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyf+s+rd+ky++g+r+nra
  FANhyb_rscf00000056.1.g00008.1   6 LPPGFRFHPTDEELVAYYLDRKINGRTIEL-EIIPEVDLYKCEPWDLPdKsFLPSKDMEWYFYSPRDRKYPNGSRTNRA 83 
                                     79****************************.99**************96435566888********************* PP

                             NAM  78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     t++gyWkatgkd++v s ++++vg+kktLv+y+grap+g +t+Wvmheyrl
  FANhyb_rscf00000056.1.g00008.1  84 TRAGYWKATGKDRAVNS-NRRAVGMKKTLVYYRGRAPHGIRTNWVMHEYRL 133
                                     ****************9.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-643157IPR003441NAC domain
PROSITE profilePS5100560.9716157IPR003441NAC domain
PfamPF023656.0E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MAPMTLPPGF RFHPTDEELV AYYLDRKING RTIELEIIPE VDLYKCEPWD LPDKSFLPSK  60
DMEWYFYSPR DRKYPNGSRT NRATRAGYWK ATGKDRAVNS NRRAVGMKKT LVYYRGRAPH  120
GIRTNWVMHE YRLTDSVCGS PSSSLKDSYA LCRIFKKTIQ IPKNNKEEKT IGNTLLNRNI  180
LGKDNSTGIN EGEASRGIEA DQDYENYSNP DYPKFLSDTS SSDLTQGTPT ETGIADDLQA  240
PFASDEANSS ANLYSLGAHG SSDNLFQDTY MPNDTSFQNY QFPYPPLELE DFPMINLAVE  300
MNTLKPQIMD DYISCDKLKD YMNGTLEEIF SLCSSQENNH VALPMQD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-57115712165NO APICAL MERISTEM PROTEIN
1ut4_B1e-57115712165NO APICAL MERISTEM PROTEIN
1ut7_A1e-57115712165NO APICAL MERISTEM PROTEIN
1ut7_B1e-57115712165NO APICAL MERISTEM PROTEIN
3swm_A1e-57115715168NAC domain-containing protein 19
3swm_B1e-57115715168NAC domain-containing protein 19
3swm_C1e-57115715168NAC domain-containing protein 19
3swm_D1e-57115715168NAC domain-containing protein 19
3swp_A1e-57115715168NAC domain-containing protein 19
3swp_B1e-57115715168NAC domain-containing protein 19
3swp_C1e-57115715168NAC domain-containing protein 19
3swp_D1e-57115715168NAC domain-containing protein 19
4dul_A1e-57115712165NAC domain-containing protein 19
4dul_B1e-57115712165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293835.10.0PREDICTED: NAC domain-containing protein 86
TrEMBLA0A2P6Q8070.0A0A2P6Q807_ROSCH; Putative transcription factor NAM family
STRINGXP_004293835.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105083341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-110NAC domain containing protein 20