PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000035.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family WOX
Protein Properties Length: 257aa    MW: 29254.6 Da    PI: 5.9791
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000035.1.g00010.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.72.6e-2088148257
                                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                        Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                                     r+R+t+t  ql++Le+lF + n +ps+++++e++++l    +++e++V++WFqNrRa+ k+
  FANhyb_rscf00000035.1.g00010.1  88 RQRWTPTLVQLQILEQLFDQgNGTPSKQKIKEMTSELsqhgQISETNVYNWFQNRRARSKR 148
                                     89*****************99**************************************97 PP

2Wus_type_Homeobox97.79e-3287150265
               Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                                     ar+RWtPt  Q++iLe+l+++G  tP+k++i+++t+eL+++G+i+++NV++WFQNr+aR+++kq
  FANhyb_rscf00000035.1.g00010.1  87 ARQRWTPTLVQLQILEQLFDQGNGTPSKQKIKEMTSELSQHGQISETNVYNWFQNRRARSKRKQ 150
                                     789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-1682154IPR009057Homeodomain-like
PROSITE profilePS5007114.75484149IPR001356Homeobox domain
SMARTSM003895.8E-1386153IPR001356Homeobox domain
SuperFamilySSF466892.4E-1787152IPR009057Homeodomain-like
CDDcd000863.57E-1188150No hitNo description
PfamPF000465.0E-1888148IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MMEWDKQHQQ KEQEIDGNGN GGVGFVKVMT DEQLETLRKQ IAVYATICEQ LVEMHKNLTA  60
QQDLAGIRMG NLYCDPRMTS SGHKITARQR WTPTLVQLQI LEQLFDQGNG TPSKQKIKEM  120
TSELSQHGQI SETNVYNWFQ NRRARSKRKQ QNATSNNAES EVETEVDSPK DKKKGPQDQI  180
LHSQQNTSAQ RAEDLCFQKP EMSSDLHFLD PQGIKEDKMF ASSSDLRSSR GGNELMTGKM  240
EVGGSYNLFQ QAEDYSM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141149RRARSKRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004287723.11e-173PREDICTED: WUSCHEL-related homeobox 8
SwissprotO817885e-91WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLA0A2P6RL801e-171A0A2P6RL80_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004287723.11e-172(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18553493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.11e-91WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]