PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000032.1.g00017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family TCP
Protein Properties Length: 317aa    MW: 33037.2 Da    PI: 7.9127
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000032.1.g00017.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP110.62.3e-3441110473
                             TCP   4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                                     ++ +++++hTkv+gR+RRvR++a caar+F+L++eLG+++d++ti WLl+ a+pai + tgt++ +a ++
  FANhyb_rscf00000032.1.g00017.1  41 QRLSTKDRHTKVEGRGRRVRMPAACAARVFQLTRELGHKTDGETIRWLLEHAEPAIVASTGTGTVPAIAV 110
                                     6789**********************************************************88888444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.0E-2944124IPR005333Transcription factor, TCP
PROSITE profilePS5136925.9724599IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0031347Biological Processregulation of defense response
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MNPTFSGQQF PAAAKKEEFE EGSLSMGLIP VPASAKPVVK QRLSTKDRHT KVEGRGRRVR  60
MPAACAARVF QLTRELGHKT DGETIRWLLE HAEPAIVAST GTGTVPAIAV SVGGSLKIPT  120
SSLANPNGEV SELPRKKRRL HCNSEFVDVE DLSSISSGLA PMATVNYGGI GGGGGGGLVP  180
MWQFGANVPA VPFFMFPNSG WAIPSDSVSG QTMFNLQGRP MSNFPVTALQ SGVEVHSCGD  240
AQATSGSISS GGGGSCSTSL GVSNSNAVTS SDTSATTAAP LSHTQLLRDL SLDTLDKREL  300
QFLGDMCGNS QAQYSKP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133139PRKKRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00064PBMTransfer from AT5G51910Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004309238.20.0PREDICTED: transcription factor TCP19
TrEMBLA0A2P6SMS71e-174A0A2P6SMS7_ROSCH; Putative transcription factor TCP family
STRINGXP_004309238.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21183086
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.27e-63TCP family protein