PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000031.1.g00021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family ARR-B
Protein Properties Length: 1778aa    MW: 198800 Da    PI: 8.1839
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000031.1.g00021.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.25.6e-2613511404155
                         G2-like    1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55  
                                      kpr++W+ +LH++Fv av++L G++kA+Pk+il+lm+ + Lt+e+v+SHLQk+Rl
  FANhyb_rscf00000031.1.g00021.1 1351 KPRVVWSVDLHRKFVAAVNKL-GIDKAVPKKILDLMNEDKLTRENVASHLQKFRL 1404
                                      79*******************.********************************8 PP

2Response_reg46.22.4e-161055114222108
                                      TCEEEEEESSHHHHHHHH.HHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
                    Response_reg   22 gyeevaeaddgeealell.kekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95  
                                      ++  v++ +++++al++l k ++  +Dl+++ ++m++++G+++lk  ++ +++lp+i+++a+++ + + + ++ Ga 
  FANhyb_rscf00000031.1.g00021.1 1055 DF-TVTSSSHPDSALRTLiK-SKdkFDLVMTAVDMSHIEGFRFLKLVHSVDKDLPVILLSAREDIQIVMKGISDGAC 1129
                                      56.77888888999988853.3336**************************************************** PP

                                      EEEESS--HHHHH CS
                    Response_reg   96 dflsKpfdpeelv 108 
                                      d+l Kp+  e+l 
  FANhyb_rscf00000031.1.g00021.1 1130 DYLLKPVRVEQLK 1142
                                      *********9986 PP

3Response_reg78.22.9e-26117012781109
                                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEE CS
                    Response_reg    1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpii 75  
                                      vlivdD+ + +++l+++l k +y +v++++++  alell+ ++  +Dl++ D++mp+mdG++ll+     e++lp+i
  FANhyb_rscf00000031.1.g00021.1 1170 VLIVDDDVTCLRVLETMLHKCQY-HVTATSHAFTALELLRGNKnkFDLVISDVQMPDMDGFKLLELVGL-EMDLPVI 1244
                                      8**********************.***************555555*******************87754.558**** PP

                                      EEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
                    Response_reg   76 vvtahgeeedalealkaGakdflsKpfdpeelvk 109 
                                      +++++g+ e++ + +  Ga d+l+Kp+ ++el +
  FANhyb_rscf00000031.1.g00021.1 1245 MLSSNGDHELVMKGVTHGACDYLVKPVRIQELKN 1278
                                      *******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF142441.5E-14102148IPR029472Gag-polypeptide of LTR copia-type
SuperFamilySSF530983.29E-20396500IPR012337Ribonuclease H-like domain
Gene3DG3DSA:3.30.420.107.2E-11401493IPR012337Ribonuclease H-like domain
PROSITE profilePS5099410.35402491IPR001584Integrase, catalytic core
PfamPF077274.1E-14713769IPR013103Reverse transcriptase, RNA-dependent DNA polymerase
SuperFamilySSF566721.16E-5734971No hitNo description
CDDcd092722.18E-558921003No hitNo description
PROSITE profilePS5011018.40510331149IPR001789Signal transduction response regulator, receiver domain
SMARTSM004482.5E-610351145IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23001.7E-1610541146No hitNo description
CDDcd001567.79E-1510541142No hitNo description
SuperFamilySSF521722.56E-1610541148IPR011006CheY-like superfamily
PfamPF000729.6E-1310551142IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521723.7E-3511671288IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23007.0E-4111671301No hitNo description
SMARTSM004488.2E-3211681280IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.12411691284IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.7E-2311701278IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.36E-2611711284No hitNo description
SuperFamilySSF466891.4E-1713481408IPR009057Homeodomain-like
PROSITE profilePS5129410.82813481407IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2713491409IPR009057Homeodomain-like
TIGRFAMsTIGR015577.8E-2413511404IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0015074Biological ProcessDNA integration
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1778 aa     Download sequence    Send to blast
MDIENMIGGL RLDDDEPRPQ SREDDQFPVG MRVLVVDDDR TSLLDFKAYF ARSKNASIGC  60
VAVYQDGKTA GLGDEDVKST KSDSSSHTPE PWENSNHAIY LHHLDQPGAV LVAQPLIEDN  120
FNEWTSSMSM ALKIKNKLGF VLGTQTKPLV NPEEQQQWER CDTLVKTWLI ASMSKAFSGS  180
VKNCKTSRDV WLDLQERVLI QSPCSSPNSK AYGTKETPYV TSKHATVPKE PKLESNIVSL  240
DPLPSVNKLY SMALRHEKQA TASNNSKVVS QLLSPCKNKL PVNHLKCTYC NWKGQDYDHC  300
RKRKAAEEGN QNNYMAATFG EFPSSKEECK QLVKMLNKNK SANVNQVIGN VSSHDEMSGK  360
AFQVPFGNQK SVWILDSEAS DHTSYATLVY LPNPTRHNQD IDNGPEFKLP AFYASKGIIH  420
QTSCVNTPQQ NGVVERKHRH LLNMARALLF QANLPKPFWG DAILVSAYLI NCTLTPMFQN  480
KIPFERLFHK APNYGHLKVF GCLCFASTHP SKPTKFDPRA IKISNMNPQS TRVSIGQNHG  540
QPYIPNQPRI SEIDNDSHRD RVLPNPTHIS SSTDQFPSSF IPPPFEPHKE SEIVHAANPK  600
PSFEVVQHIG LLTDPPLAPF SSTDSPTPSV TPLHRSTLPT KPPGFLHDYH VEATLHSRAL  660
PPSSPSTCMP HHSLSQAVQH HEWREAMKQE VDALHQNKTW SLVLLPSNKR PIVEGIDYRE  720
TFAHVAKLTT NQVFLNLAAL KGLYLHQLDV NNAFLNEDLT EEVYMQLPPD DAILVGNNLS  780
DITAQKRFLH NNSSLRISAN LKDTRFLASK PSRFPVDHNL ALTQTRGELL AYPSQYRRLV  840
GRMIYLTITR PNLVYAVHIL SQFMHKPKQL HLNAAHQVLR YIKNTHGQGK LAPVSWRTKK  900
QSTISCSSAE AEYRSMAFAC CEVIWLQNIL KDLGAKQLQP TRLFYDKQAV IHIASNPVFH  960
ERTKHIEIDC HVVREKMQRG VIRVVHVGTK KQPVDLFTKP LSSVQFEFLL SKLGVINIHL  1020
NLKGSIEASK DASVGCVAVY RDGKAARRFK YVLMDFTVTS SSHPDSALRT LIKSKDKFDL  1080
VMTAVDMSHI EGFRFLKLVH SVDKDLPVIL LSAREDIQIV MKGISDGACD YLLKPVRVEQ  1140
LKLICSLLEK MTIEPLFDDQ RDQFPIGMRV LIVDDDVTCL RVLETMLHKC QYHVTATSHA  1200
FTALELLRGN KNKFDLVISD VQMPDMDGFK LLELVGLEMD LPVIMLSSNG DHELVMKGVT  1260
HGACDYLVKP VRIQELKNIW QHVIRRKKGD SKDQTNSGNQ DKSHIGSCGG GMGNSDQNVK  1320
LTKKRKDQDE DEDDNRDEDG YDNDDPSTQK KPRVVWSVDL HRKFVAAVNK LGIDKAVPKK  1380
ILDLMNEDKL TRENVASHLQ KFRLYLKRIS CVANQQANMM AAIGSSDSSY LRMSTFNGGR  1440
NYHALTGPGQ FNNTGFRSMP LNGMIGRVNA PAGLGLHCLP SSGSIKLGQG QHSSNSILDQ  1500
GIFPGNRNGS MLQGNLELDQ RHSKGVNGTP VFPISSGFPD AKLTMSRSSD AVGLTDNPIL  1560
SHPRDFEGGR EYVNQSSLPV APLKTEFCAP FLDHGRLNDS WASAAQSSAF RSNSFPSSNT  1620
RDSIPVVMSS QMRNCQFDAP INSVSSHLQD PGTDVLIQPS AVSSTAGQII DSDPTQGWVW  1680
MDHKQDSPYH HSDTVSSSMD SLMPANVPVA FDHNLDSKGT TLQRNMDFNS IGQSNFLDPL  1740
HTKFDEIDRS LEASMNMNLK PGWKRDEVTS IGRRIEQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-2413471410164ARR10-B
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-112response regulator 12