PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000030.1.g00023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family M-type_MADS
Protein Properties Length: 303aa    MW: 35096.8 Da    PI: 8.4296
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000030.1.g00023.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.41.2e-151252242
                                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                                     i+n+  r+vtf kR++g++KK +EL  LCd++ +vii+ +
  FANhyb_rscf00000030.1.g00023.1 12 LIKNEKSRNVTFRKRKKGLMKKTFELNKLCDVQCSVIIYEK 52
                                    59************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.6E-9164IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.231350IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-9525IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-17683IPR002100Transcription factor, MADS-box
CDDcd002664.67E-17692No hitNo description
PfamPF003193.6E-161358IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-92540IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-94061IPR002100Transcription factor, MADS-box
Gene3DG3DSA:3.30.1440.102.4E-666162IPR022803Ribosomal protein L5 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MGRSNTKLPL ELIKNEKSRN VTFRKRKKGL MKKTFELNKL CDVQCSVIIY EKKPNGQLVR  60
PETYPENPEE VKQIIDRFVS KSAKVRKVEN LADYFGKQIM QVKKETAKLR QKNNETRFPS  120
WDDRLNDLSL DQLLDLLKKL DHKIEDVHQR FDKQYAIDDG ILSQTALFSN NNLEYSQMVA  180
LNQYPNNGSM MYISDRALPE EQSNLQVFQN NLINYPQSYN SGSIVMNRNG MPWQNYNIQS  240
APSTSNGSNY DESITSLRLC IQCPQVTYVI MLTNSCISKA SEGDDHQHIE SQQNHLNLFS  300
LEL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12327RKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011467688.10.0PREDICTED: agamous-like MADS-box protein AGL21
TrEMBLA0A2P6S6E51e-158A0A2P6S6E5_ROSCH; Putative transcription factor MADS-type1 family
STRINGXP_004305907.11e-143(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26650.11e-12AGAMOUS-like 36