PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000024.1.g00029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GRF
Protein Properties Length: 546aa    MW: 58756.8 Da    PI: 8.0607
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000024.1.g00029.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.47e-25148191144
                             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                                     d+epgrC+RtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  FANhyb_rscf00000024.1.g00029.1 148 DPEPGRCKRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKHVE 191
                                     79****************************************97 PP

2QLQ55.32e-1989121234
                             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                                     +FT++Q+ +L++Q+++yKy++a++PvP +Ll++
  FANhyb_rscf00000024.1.g00029.1  89 PFTNQQWKELERQAMIYKYMMASLPVPRDLLFP 121
                                     8*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.3E-1088124IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.9E-1389121IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.40389124IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.202148192IPR014977WRC domain
PfamPF088791.7E-20149191IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MMMMVHHDNR GRPDQRRDGG DGPTCNRPPG VAEPVAGSSS SNSTSGGSVL RGLQPFQYLS  60
NTNTHHHNST SLRSPGGMTT AAAAALGFPF TNQQWKELER QAMIYKYMMA SLPVPRDLLF  120
PTTTSSSSIS QSPLSGGGFN LRLSNSTDPE PGRCKRTDGK KWRCSRDVAP DQKYCERHMH  180
RGRPRSRKHV EIHANNTTTA AATMTTAKKL RRDNNSNNIP PICAHNLPNP EMSKNGYPTQ  240
FFGSTLQPFH QTPVYLDKSG VKSATFGGGG GVNSVSSHRG VRGMEWMMKS EAPAISSSDA  300
QWQDLMQSNK TELSSCSRIP YFDANTSIFG QRSEQESYLN LNSYTSFNAG DAHHHQQDDN  360
DCTMFLSPDV VGLENPLLEE TPRSFIDAWS KNDNGDNITS VPSSGHLSPS SLTLSMGGYN  420
SRSDEMGQTH MSLGCNDGSG NETGPPQIST WLTPSSWVSS PPGGPLAEVL KPATSAVSTP  480
SSPITTNGNH GEFSSPLGTT TVSSPSGVLQ KTLASFSDSS GNSSPNLTSS KSKTEAVSLW  540
LNQSKA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307906.10.0PREDICTED: growth-regulating factor 3
TrEMBLA0A2P6SPE70.0A0A2P6SPE7_ROSCH; Putative transcription factor interactor and regulator C3H-WRC/GRF family
STRINGXP_004307906.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.18e-34growth-regulating factor 7