PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000019.1.g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family SBP
Protein Properties Length: 530aa    MW: 59374.3 Da    PI: 7.1937
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000019.1.g00013.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.13.8e-41193269177
                                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                                     +Cqv+gC++dls+ keyh+rh+vC++hsk++ v+v+g+eqrfCqqCsrfh l efD+ krsCrrrLa+hn+rrrk+q
  FANhyb_rscf00000019.1.g00013.1 193 TCQVHGCNMDLSSSKEYHKRHRVCDAHSKTAIVIVNGIEQRFCQQCSRFHLLAEFDDVKRSCRRRLAGHNQRRRKPQ 269
                                     6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.4E-32189255IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.094191268IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.02E-38192273IPR004333Transcription factor, SBP-box
PfamPF031102.5E-31194267IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MCFLACIILV AFSVPLQIET YFTFVVSGRH MEPWSFGSEG KGFLFADEMD IPIDAFAKST  60
KAFLEWDNKT CFNFDKESVE SMEFMDSGLP DTMKEPFHGN QVVDILSGVG CNDSSNNTVA  120
SPTCLMTSSS SWGDGESGSK FSSPVCESSS QDSSLIALKL GRLADSKYGK DSQHLKERSK  180
RARTKGSYYQ TITCQVHGCN MDLSSSKEYH KRHRVCDAHS KTAIVIVNGI EQRFCQQCSR  240
FHLLAEFDDV KRSCRRRLAG HNQRRRKPQL DTFDCKSHNW LQSYQGIGYL GTSLPKRTPF  300
VFSDILPGGV LYPEESNQYG HIKTEDELTY SQCVTRTSNR QSIPNSFLHL HGLAKQHASG  360
VPISGHEYSV FDTASDVQKE SGASTYQGVL SLLSSQSQSS IHSARNQVAT PLQMQRTHHG  420
AGQNNEWPST VKALEKCGRN GSFPCRMNSM GTDQMDSVMI SDSSHAVDFQ HRTDRVQGSA  480
CFSHKYHLSP ENGPTFDLLQ LSSHFQRVEQ ERNFLQVKQE QGDFYCFPQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-271942671184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004297216.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A2P6R2L50.0A0A2P6R2L5_ROSCH; Putative transcription factor SBP family
STRINGXP_004297216.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-46SBP family protein