PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000010.1.g00037.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 701aa    MW: 77128.8 Da    PI: 8.1236
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000010.1.g00037.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.82.5e-5451311129
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhPtdeel+++yL +kv++ +++  ++++ vd++k+ePwdLp k++ +ekewyfF  rd+ky+tg r+nrat+
  FANhyb_rscf00000010.1.g00037.1   5 LPPGFRFHPTDEELITYYLGRKVSDVSFTS-QAVAVVDLNKCEPWDLPGKASMGEKEWYFFNLRDRKYPTGLRTNRATE 82 
                                     79*************************999.88***************988999************************* PP

                             NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                     +gyWk+tgkdke+l+ +g lvg+kktLvfykgrap+gekt+Wvmheyrle
  FANhyb_rscf00000010.1.g00037.1  83 AGYWKTTGKDKEILR-QGVLVGMKKTLVFYKGRAPRGEKTNWVMHEYRLE 131
                                     **************9.99******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-633154IPR003441NAC domain
PROSITE profilePS5100560.1975154IPR003441NAC domain
PfamPF023656.0E-286130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MQENLPPGFR FHPTDEELIT YYLGRKVSDV SFTSQAVAVV DLNKCEPWDL PGKASMGEKE  60
WYFFNLRDRK YPTGLRTNRA TEAGYWKTTG KDKEILRQGV LVGMKKTLVF YKGRAPRGEK  120
TNWVMHEYRL ENKHHPFKSS ASKEEWVVCR VFQKSIALKK PQQMTSSSPQ SVDSPGETNS  180
MVNEFGDVEL PNFMNNVANS STTGFLSNMS IPQGNNYNII DKAAASGAIL PAAALGSWPS  240
SLLSPSNLSS VNSLLLRALQ LRSSSASATT TATAAWIMSH FGSDHNMNSS NVQASSSSKD  300
QIMDSMPQSQ QHLEQPFNLD SIWLQPRVEN LSGFPWKTSN LEDCLSSKES QKGSQPSVEA  360
CNRLKLIKES DRTEPAASEA DPHPESASHQ SAFPVAFDEC IPFGCQVLIS IVFFRQAQIM  420
LGMVRPPQSM PNIQPVTSQH LQQLVQPTQQ SNTQVAPSLP GLGVQDQPGP SQMQAPARKQ  480
YQNQPTFNLQ SQPMSSYPLQ TQQQPKGHLN PQMTPASLPQ SSQLPNPPAH PHHSSQPPQL  540
HQPQMSSYNQ LQQPLQTSGG HHMPLQPPLP PQPRPSMSNF HHQYPPQMGP NSGYQHPSQS  600
MFHSGTKPPT SVGPSFPLGQ PPLPNHPPPQ SMYQGGGMHL GSEYSNQVGT SMQADRGTWM  660
SGPPESSSVP QLSGPPSLVP GQMPGSQLQL MIFCFVFTVS L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-52216017174NAC domain-containing protein 19
3swm_B2e-52216017174NAC domain-containing protein 19
3swm_C2e-52216017174NAC domain-containing protein 19
3swm_D2e-52216017174NAC domain-containing protein 19
3swp_A2e-52216017174NAC domain-containing protein 19
3swp_B2e-52216017174NAC domain-containing protein 19
3swp_C2e-52216017174NAC domain-containing protein 19
3swp_D2e-52216017174NAC domain-containing protein 19
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2P5F9N90.0A0A2P5F9N9_TREOI; NAC domain containing protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49463356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.12e-97NAC domain containing protein 58