PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000007.1.g00035.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 383aa    MW: 43904.3 Da    PI: 6.0321
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000007.1.g00035.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260115.43.8e-36801801101
                          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgv 79 
                                     aCaaCk++rrkC+++C+lapyfp +qpk f+n+hklFG+ n+lk+lk++++  + ++m+s++ +A++r + PvyG+ +v
  FANhyb_rscf00000007.1.g00035.1  80 ACAACKYQRRKCTPECPLAPYFPPDQPKMFQNAHKLFGVCNILKILKTVDPCFKFETMKSIICQANIREKFPVYGCWEV 158
                                     7****************************************************************************** PP

                          DUF260  80 ilklqqqleqlkaelallkeel 101
                                     i++lq q++ +++el+ ++++l
  FANhyb_rscf00000007.1.g00035.1 159 IWQLQYQIMAAEQELQNVHKQL 180
                                     *****************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.87679180IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-3580177IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MLLLIPTFFF TLTIFLTSFF FHILLLHHYR HLCIHLSNSF PLSFNRLHLP HWSEPPPQPS  60
RRDLLGNQDI MTLKGATSQA CAACKYQRRK CTPECPLAPY FPPDQPKMFQ NAHKLFGVCN  120
ILKILKTVDP CFKFETMKSI ICQANIREKF PVYGCWEVIW QLQYQIMAAE QELQNVHKQL  180
ALYRQHHYHQ QQQISAMPDY VTSQLELGMA PPNNNNTISL LNHSTPQSYD NNYNAIPHAL  240
PVTQQQQQHY SNRSDDAYTS AYDIDSKQTI TTENVLWAQN PFTNNSINEN NDNAETVQSQ  300
FGVSQTLAMG SEDVQDYDEL HPFFDTIDDR QSYIDSKEAY DSSSSEESLK DTTQISMDHA  360
ADDNTLKSAA ACFSLTSVKL SVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-24721834114LOB family transfactor Ramosa2.1
5ly0_B5e-24721834114LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011464557.10.0PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A2P6P2D10.0A0A2P6P2D1_ROSCH; Putative transcription factor AS2-LOB family
STRINGXP_004301305.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.13e-54LOB domain-containing protein 27