PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000005.1.g00044.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HD-ZIP
Protein Properties Length: 780aa    MW: 85774.5 Da    PI: 6.2364
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000005.1.g00044.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.82.8e-2185140156
                                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                     ++k +++t++q++eLe++F+++++p++++r +L+++lgL+++qVk+WFqNrR+++k
  FANhyb_rscf00000005.1.g00044.1  85 KKKYHRHTPSQIQELESFFKECPHPDEKQRLDLSRRLGLETKQVKFWFQNRRTQMK 140
                                     79999************************************************999 PP

2START1749.5e-552965121204
                                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG CS
                           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke 70 
                                     ela ea++elv++a+a++p+W+kss    e  +  + l+k ++  +       ++a+r+s +v+ +++ lve+++d + 
  FANhyb_rscf00000005.1.g00044.1 296 ELAGEAMDELVRMAQADSPLWMKSSdggiE--TLNVELYKTSSCIStrqsgLVTDASRDSCMVIINSMALVETMMDAN- 371
                                     5799*********************99552..44444444433333455569**************************. PP

                                     CT-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--. CS
                           START  71 qWdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe 138
                                     +W+ +++    +a+t+  issg      g++q m aelq+lsplvp R   f+R+++q+ +g+w++vdvSvd  q+ + 
  FANhyb_rscf00000005.1.g00044.1 372 RWTDMFPtlvsRASTIGIISSGpsgtrnGTIQMMLAELQMLSPLVPvRPLKFLRFSKQHAEGVWAVVDVSVDIHQDAS- 449
                                     ****************************************************************************87. PP

                                     -TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
                           START 139 sssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                                        ++ +++lpSg+++++++ng+skvtw+eh +++++ +h+ll++l++sg+ +ga++w+ tlqr c
  FANhyb_rscf00000005.1.g00044.1 450 ---SMNCRRLPSGFIVQDMPNGYSKVTWIEHSEYNESGVHQLLQPLLRSGIGFGAQRWLTTLQREC 512
                                     ...699999*******************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.27E-2072142IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-2178148IPR009057Homeodomain-like
PROSITE profilePS5007117.78382142IPR001356Homeobox domain
SMARTSM003896.3E-1984146IPR001356Homeobox domain
PfamPF000466.1E-1985140IPR001356Homeobox domain
CDDcd000862.22E-1985142No hitNo description
PROSITE patternPS000270117140IPR017970Homeobox, conserved site
PROSITE profilePS5084840.874287517IPR002913START domain
SuperFamilySSF559611.83E-28291514No hitNo description
CDDcd088758.73E-99295512No hitNo description
SMARTSM002342.9E-41296514IPR002913START domain
PfamPF018528.9E-47296512IPR002913START domain
SuperFamilySSF559611.49E-16542771No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 780 aa     Download sequence    Send to blast
MNFGGSISNS GGVGGSRVVA EIDPHSSGGA IAQPHFTPNS MQSSSALSLS IVQQNMDGHG  60
DLDLIAESFR PWNYPADEDD HPRRKKKYHR HTPSQIQELE SFFKECPHPD EKQRLDLSRR  120
LGLETKQVKF WFQNRRTQMK TQLERHENII LRQENDKLRA ENGVMKEAMS NPICHNCGGP  180
AIPGQISFDE HQLRIENARL NDELSRICTL AQKFLGRPIS NLAAPPSLPS STTGLDLAMG  240
INGMGGLHAG SSHRLSMGFE LGDGVGSSSP MMPLTKPAIG MPNELQHLND RHVYLELAGE  300
AMDELVRMAQ ADSPLWMKSS DGGIETLNVE LYKTSSCIST RQSGLVTDAS RDSCMVIINS  360
MALVETMMDA NRWTDMFPTL VSRASTIGII SSGPSGTRNG TIQMMLAELQ MLSPLVPVRP  420
LKFLRFSKQH AEGVWAVVDV SVDIHQDASS MNCRRLPSGF IVQDMPNGYS KVTWIEHSEY  480
NESGVHQLLQ PLLRSGIGFG AQRWLTTLQR ECDALSFLMS SANPNEVPRG LSMNSKKSML  540
RLAQRMMQSF CSGVCGSLVH QWDKLCIDNV SDNVRVMVRQ SLEVGEPSGF VLSAATSVWM  600
PVSRSRLFDF LRNWQLRGQW DILVGCRPLQ AMVQIDKDHE GGNSVSLFNA KGLDASNNNN  660
MLMFQETMTD ASGSIIVYAP ITSTSSDIMR DVVYEGGDST YVELLPSGFA ILPCVTSEYV  720
KEEGNGSDEG GCLLTVGFQI VCDGGQPTSK LTMHSVKTII DLISSTVQKI KSALQINDGP
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004309219.20.0PREDICTED: homeobox-leucine zipper protein HDG1 isoform X1
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLA0A2P6SMY10.0A0A2P6SMY1_ROSCH; Putative transcription factor & lipid binding Homobox-WOX family
STRINGXP_004309219.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Horstman A, et al.
    AIL and HDG proteins act antagonistically to control cell proliferation.
    Development, 2015. 142(3): p. 454-64
    [PMID:25564655]