PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000004.1.g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family WOX
Protein Properties Length: 287aa    MW: 32782.5 Da    PI: 7.2041
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000004.1.g00018.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.91.1e-2067128157
                                     TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                        Homeobox   1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                                     r +R+++t+eql +Leel+++  ++p+a+++++ +++l    +++ ++V++WFqN+Ra+e++
  FANhyb_rscf00000004.1.g00018.1  67 RGSRWNPTPEQLMALEELYRSgLKTPTAQQIRQVTAQLrnfgRIEGKNVFYWFQNHRARERQ 128
                                     568*****************99**************************************97 PP

2Wus_type_Homeobox110.59.1e-3668130365
               Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                                      +RW+PtpeQ++ Leely+sGl+tP++++i+++ta+L+++G+ie+kNVfyWFQN++aRerqk+
  FANhyb_rscf00000004.1.g00018.1  68 GSRWNPTPEQLMALEELYRSGLKTPTAQQIRQVTAQLRNFGRIEGKNVFYWFQNHRARERQKR 130
                                     58***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007112.00164129IPR001356Homeobox domain
SuperFamilySSF466896.84E-1364135IPR009057Homeodomain-like
SMARTSM003892.6E-666133IPR001356Homeobox domain
CDDcd000860.003267123No hitNo description
PfamPF000463.2E-1867128IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.3E-969128IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MWMTMECSTG GCTDPSIHST SNTTQNPVLP CNHHHHQMVR VTSSQPSRSS RGCFYIDKQP  60
AAAAPSRGSR WNPTPEQLMA LEELYRSGLK TPTAQQIRQV TAQLRNFGRI EGKNVFYWFQ  120
NHRARERQKR RRQLMSMYQS DSKQQQQTLT NNTVSGLQDK ESAGGLTNSS LEVEQQIKWK  180
LPNCTVLSDQ QESSSVLQER MMSMVQSTSS RQLVEQSNSP RPTSDTNAPA TLSYTKFLDF  240
HHYYDYDCGM VLSAPIIYKG EEEEEEENRE TQTLELFPLK SDNVKGD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011463131.10.0PREDICTED: WUSCHEL-related homeobox 3-like
TrEMBLA0A2P6PTZ01e-114A0A2P6PTZ0_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004298470.11e-100(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3380522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01500.12e-27WOX family protein