PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon20341735_s.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 121aa    MW: 13870.7 Da    PI: 10.8436
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon20341735_s.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like65.11.3e-2083120239
                           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvk 39 
                                       pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk
  FANhyb_icon20341735_s.1.g00001.1  83 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVK 120
                                       9***********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.05E-780120IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-1681120IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-1483120IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MGGFESTRFN GITMESLRVP QHQLQYLNHQ QQQQLQHQHQ CGAGVGIGAH HHLHGDFSSN  60
NGFIMRSRFT PKSYQSKRNM RAPRMRWTSS LHARFVHAVE LLGGHERATP KSVLELMDVK  120
D
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011464470.12e-64PREDICTED: transcription repressor KAN1 isoform X2
TrEMBLA0A2P6P1N42e-46A0A2P6P1N4_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004299501.17e-63(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-28G2-like family protein