PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon18909931_s.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GeBP
Protein Properties Length: 89aa    MW: 9732.84 Da    PI: 9.0685
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon18909931_s.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57363.26.3e-203388257
                            DUF573  2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveK 57
                                      ++ rlw e+Dei++L G+i+fkak+g++ps+++ af+ef+++s++++v+k+ql++K
  FANhyb_icon18909931_s.1.g00001.1 33 KAGRLWGEDDEIAILEGMIEFKAKNGTDPSSNVGAFHEFLRRSLKADVNKNQLMDK 88
                                      5679***************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.0E-153688IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
PAKRAAESDP NPKDSKKKKK GSSGSGEDEE TKKAGRLWGE DDEIAILEGM IEFKAKNGTD  60
PSSNVGAFHE FLRRSLKADV NKNQLMDKA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011463030.11e-43PREDICTED: mediator-associated protein 1-like
SwissprotQ9SYA94e-15STKLD_ARATH; Probable transcription factor At1g61730
TrEMBLA0A2P6S2H84e-38A0A2P6S2H8_ROSCH; Putative transcription factor GeBP family
STRINGXP_004289148.12e-43(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.12e-16DNA-binding storekeeper protein-related transcriptional regulator