PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00045718_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family TCP
Protein Properties Length: 120aa    MW: 13124.8 Da    PI: 11.2265
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00045718_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP72.31.5e-2276120246
                               TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsk 46 
                                       a+kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++
  FANhyb_icon00045718_a.1.g00001.1  76 AVKKPPSKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQ 120
                                       78*****************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136919.89482120IPR017887Transcription factor TCP subgroup
PfamPF036347.4E-1882119IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
LYPPQPTLPF SLPTGLAART AAPYRSVSMS NSEAPNNEQL SNGAAAAAMM MERQQQQQQT  60
QQQQTAQQPS SNGVLAVKKP PSKDRHSKVD GRGRRIRMPI ICAARVFQLT RELGHKSDGQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301414.14e-59PREDICTED: transcription factor TCP7-like
TrEMBLD9ZJD59e-39D9ZJD5_MALDO; TCP domain class transcription factor
STRINGXP_004301414.11e-58(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54693153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08330.11e-27TCP family protein