PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00044463_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family WOX
Protein Properties Length: 89aa    MW: 10197.3 Da    PI: 6.5313
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00044463_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox44.82.1e-143489252
                                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHH CS
                          Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrR 52
                                      r+R+ +++eq+ +Le+ F++   +p +ee  ++ k l    ++ +++V++WFqNrR
  FANhyb_icon00044463_a.1.g00001.1 34 RSRWIPKPEQILILESIFNSgMVNPPKEETVRIRKLLekfgSVGDANVFYWFQNRR 89
                                      89*****************99**********************************9 PP

2Wus_type_Homeobox94.87.3e-313389258
                 Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrk 58
                                      +r+RW P+peQi iLe++++sG+++P+kee+ ri++ Le++G ++d+NVfyWFQNr+
  FANhyb_icon00044463_a.1.g00001.1 33 VRSRWIPKPEQILILESIFNSGMVNPPKEETVRIRKLLEKFGSVGDANVFYWFQNRR 89
                                      589****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-71189IPR009057Homeodomain-like
SuperFamilySSF466893.85E-112889IPR009057Homeodomain-like
PROSITE profilePS500719.8633089IPR001356Homeobox domain
PfamPF000463.4E-123489IPR001356Homeobox domain
CDDcd000861.95E-43489No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MEDHQGQAGG DQEAKEPNSP NSHSSSERST EPVRSRWIPK PEQILILESI FNSGMVNPPK  60
EETVRIRKLL EKFGSVGDAN VFYWFQNRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00330DAPTransfer from AT3G03660Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004289578.23e-52PREDICTED: WUSCHEL-related homeobox 11
SwissprotQ6X7J32e-36WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLA0A2P6RHC65e-48A0A2P6RHC6_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004289578.11e-51(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58983152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.12e-34WUSCHEL related homeobox 11
Publications ? help Back to Top
  1. Hu X,Xu L
    Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis.
    Plant Physiol., 2016. 172(4): p. 2363-2373
    [PMID:27784768]
  2. Sheng L, et al.
    Non-canonical WOX11-mediated root branching contributes to plasticity in Arabidopsis root system architecture.
    Development, 2017. 144(17): p. 3126-3133
    [PMID:28743799]
  3. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]
  4. Baesso B, et al.
    Transcription factors PRE3 and WOX11 are involved in the formation of new lateral roots from secondary growth taproot in A. thaliana.
    Plant Biol (Stuttg), 2018. 20(3): p. 426-432
    [PMID:29450949]