PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00043296_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 93aa    MW: 10718.1 Da    PI: 4.8405
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00043296_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM56.78.2e-184893148
                               NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                                      lp+GfrFhPt+eel+++yLkkk++g++++   vi+e+di+++ePwdLp
  FANhyb_icon00043296_a.1.g00001.1 48 LPVGFRFHPTEEELIDHYLKKKIKGHDFND--VIPEIDICSYEPWDLP 93
                                      79***********************99655..9**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-173993IPR003441NAC domain
PROSITE profilePS5100520.6954893IPR003441NAC domain
PfamPF023655.0E-84983IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
YLKKKIKGHD FNDLMSSLVT VSTVVTEQPQ EHSLFDESWP GMATSASLPV GFRFHPTEEE  60
LIDHYLKKKI KGHDFNDVIP EIDICSYEPW DLP
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). {ECO:0000250|UniProtKB:Q949N0}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold, heat and drought stresses. {ECO:0000269|PubMed:17158162}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307318.19e-30PREDICTED: NAC transcription factor 25-like
SwissprotB5X5703e-16NAC14_ARATH; NAC domain-containing protein 14
TrEMBLA0A2P6SIZ05e-22A0A2P6SIZ0_ROSCH; Putative transcription factor NAM family
STRINGXP_004307318.14e-29(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114331739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.23e-18TCV-interacting protein