PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00039646_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 63aa    MW: 7516.68 Da    PI: 5.6582
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00039646_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM55.61.8e-171863248
                               NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                                      +pGfrFhPtdeelv +yLk+k+ +k+l+l +vi+e+d+yk++P++Lp
  FANhyb_icon00039646_a.1.g00001.1 18 QPGFRFHPTDEELVLYYLKRKICKKRLKL-NVIAETDVYKWDPEELP 63
                                      69***************************.99**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-171063IPR003441NAC domain
PROSITE profilePS5100518.9121763IPR003441NAC domain
PfamPF023652.5E-81942IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MVSEDGLISA FCDGHFWQPG FRFHPTDEEL VLYYLKRKIC KKRLKLNVIA ETDVYKWDPE  60
ELP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13544KRKICKKRLK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Transcriptional activator that acts as positive regulator of AOX1A during mitochondrial dysfunction. Binds directly to AOX1A promoter. Mediates mitochondrial retrograde signaling. {ECO:0000269|PubMed:24045017}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold and drought stresses. {ECO:0000269|PubMed:17158162}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024162540.16e-38NAC domain-containing protein 17-like isoform X1
SwissprotQ9XIC53e-23NAC17_ARATH; NAC domain-containing protein 17
TrEMBLA0A2P6PRH12e-36A0A2P6PRH1_ROSCH; Putative transcription factor NAM family
STRINGXP_008381037.12e-31(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114331739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-12NAC domain containing protein 17
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Van Aken O, et al.
    Mitochondrial and Chloroplast Stress Responses Are Modulated in Distinct Touch and Chemical Inhibition Phases.
    Plant Physiol., 2016. 171(3): p. 2150-65
    [PMID:27208304]
  3. Van Aken O,Ford E,Lister R,Huang S,Millar AH
    Retrograde signalling caused by heritable mitochondrial dysfunction is partially mediated by ANAC017 and improves plant performance.
    Plant J., 2016. 88(4): p. 542-558
    [PMID:27425258]
  4. Hu Z, et al.
    Mitochondrial Defects Confer Tolerance against Cellulose Deficiency.
    Plant Cell, 2016. 28(9): p. 2276-2290
    [PMID:27543091]
  5. Chi YH, et al.
    The membrane-tethered NAC transcription factor, AtNTL7, contributes to ER-stress resistance in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2017. 488(4): p. 641-647
    [PMID:28088515]
  6. Van Aken O,Pogson BJ
    Convergence of mitochondrial and chloroplastic ANAC017/PAP-dependent retrograde signalling pathways and suppression of programmed cell death.
    Cell Death Differ., 2017. 24(6): p. 955-960
    [PMID:28498364]
  7. Cheng P, et al.
    The ERA-Related GTPase AtERG2 Associated with Mitochondria 18S RNA Is Essential for Early Embryo Development in Arabidopsis.
    Front Plant Sci, 2018. 9: p. 182
    [PMID:29497438]