PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00030997_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family TCP
Protein Properties Length: 96aa    MW: 10882.1 Da    PI: 10.7452
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00030997_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP42.32.8e-136696232
                               TCP  2 agkkdrhskihTkvggRdRRvRlsaecaarf 32
                                       g+kdrhsk+ T++g+RdRRvRls+++a++f
  FANhyb_icon00030997_a.1.g00001.1 66 SGGKDRHSKVWTSKGLRDRRVRLSVSTAIQF 96
                                      689**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036348.0E-136796IPR005333Transcription factor, TCP
PROSITE profilePS5136916.586896IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
HECDAMEVEE IQAQQPCKFP RIGNGGRGSS SVAKNPDEED NNREIKTTNR LNGWHHSRII  60
RVSRASGGKD RHSKVWTSKG LRDRRVRLSV STAIQF
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). Participates in ovule develpment (PubMed:25378179). Promotes light-regulated transcription of CHS, CAB, HYH and HY5. Regulates positively photomorphogenesis (e.g. hypocotyl elongation inhibition and cotyledon opening in response to blue light) (PubMed:26596765). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179, ECO:0000269|PubMed:26596765}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the miRNA miR-JAW (PubMed:12931144). Induced by blue light. Stabilized by light but labile in darkness due to proteasome-dependent proteolysis (at protein level) (PubMed:26596765). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:26596765}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293547.17e-54PREDICTED: transcription factor TCP2
RefseqXP_011460218.17e-54PREDICTED: transcription factor TCP2
SwissprotQ93V432e-19TCP2_ARATH; Transcription factor TCP2
TrEMBLA0A2P6Q5R35e-43A0A2P6Q5R3_ROSCH; Putative transcription factor TCP family
STRINGXP_004293547.13e-53(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40193156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18390.29e-22TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2
Publications ? help Back to Top
  1. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  2. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]