PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00021436_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 149aa    MW: 16803.5 Da    PI: 7.04
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00021436_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM43.31.1e-13101146248
                               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 
                                       ppG+rF+P+deelv +yL+kk+ +++l+  + i ev++y+++P++L 
  FANhyb_icon00021436_a.1.g00001.1 101 PPGYRFNPRDEELVRYYLQKKIMDEPLPP-NKIMEVNLYRYNPETLA 146
                                       9*************************999.77************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.32E-1597148IPR003441NAC domain
PROSITE profilePS5100517.706100149IPR003441NAC domain
PfamPF023654.4E-7101125IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
ASPSMSSPSK SPTMEPPVQQ SHPHPKASNS VTEATADRGS PSPKPLQQIP HEAAARTHHH  60
VAHNNGASSV DHHRFSDEEE ELNNFNNNQK KQQDAFLSSF PPGYRFNPRD EELVRYYLQK  120
KIMDEPLPPN KIMEVNLYRY NPETLAGKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293170.29e-81PREDICTED: uncharacterized protein LOC101294338
TrEMBLA0A2P6QFQ64e-49A0A2P6QFQ6_ROSCH; Putative transcription factor NAM family
STRINGXP_004293170.16e-74(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2587622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.17e-12NAC domain containing protein 32