PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00018154_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 55aa    MW: 6358.25 Da    PI: 7.5135
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00018154_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM43.41.1e-13855148
                               NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                                      lp+G+rF+P+de l+++yL+kk ++++ e++ vi+e+d++k+eP+ Lp
  FANhyb_icon00018154_a.1.g00001.1  8 LPKGCRFQPSDEVLLSHYLQKKNQRQDPEITAVIPEIDVTKHEPRYLP 55
                                      799***************************999************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.15E-12355IPR003441NAC domain
PROSITE profilePS5100516.266855IPR003441NAC domain
PfamPF023651.2E-5945IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 55 aa     Download sequence    Send to blast
MSYGGFSLPK GCRFQPSDEV LLSHYLQKKN QRQDPEITAV IPEIDVTKHE PRYLP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011468877.12e-30PREDICTED: NAC domain-containing protein 4-like isoform X2
TrEMBLA0A2P6SIY74e-19A0A2P6SIY7_ROSCH; Putative transcription factor NAM family
STRINGXP_004308753.14e-25(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16106410
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.11e-10NAC 014